Esterase (gene EstJN) from Clostridium butyricum

Enzyme Description

Species

Extremophile

EC Number

3.1.1.1 ↗

Sequence

Length: 187 amino acids

MNNHIDIIFFGDSLTFGYGVSKEKSWVYLIANKLNLSYINNGKNGDTTPSMLSRFYSDALKYNPHTIFIMGGTNDLLCGRSISSIIENIEIMIQDSYKINAKVIIGIPPKIIGSMANELFIPSSFYSYAEKSLTQLRDSLILLSHKYKTNIIDFYSLELTQDLYIDGLHLSSEGNNIMYKEAVKILN

Chuan Wang et al. (2025) — Expression and characterization of a Clostridium Butyricum esterase from pit cellar of Chinese liquor and its potential in flavor ester synthesis

Archives of Microbiology · doi:10.1007/s00203-025-04433-w ↗ · Activity - Classical

7 measurements ▼

Database ID

GenBank (nucleotide) : PP034557.1

Sequence Annotation

Explicit - Provided

Protein Source

Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (7 measurements)

7 measurements

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Methanol	10%	100.0	123.2	%	25 mM Tris-HCl buffer	8	30°C	5 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent in the presence of organic solvent	Ethanol	10%	100.0	95.5	%	25 mM Tris-HCl buffer	8	30°C	5 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Benzene	10%	100.0	37.3	%	25 mM Tris-HCl buffer	8	30°C	5 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Acetone	10%	100.0	56.0	%	25 mM Tris-HCl buffer	8	30°C	5 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Isopropanol	10%	100.0	50.3	%	25 mM Tris-HCl buffer	8	30°C	5 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Ethyl Acetate	10%	100.0	91.2	%	25 mM Tris-HCl buffer	8	30°C	5 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Acetonitrile	10%	100.0	12.3	%	25 mM Tris-HCl buffer	8	30°C	5 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Classical aqueous control (in %)

Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Methanol	10%	100.0	123.2	%	25 mM Tris-HCl buffer	8	30°C	5 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent in the presence of organic solvent	Ethanol	10%	100.0	95.5	%	25 mM Tris-HCl buffer	8	30°C	5 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Benzene	10%	100.0	37.3	%	25 mM Tris-HCl buffer	8	30°C	5 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Acetone	10%	100.0	56.0	%	25 mM Tris-HCl buffer	8	30°C	5 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Isopropanol	10%	100.0	50.3	%	25 mM Tris-HCl buffer	8	30°C	5 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Ethyl Acetate	10%	100.0	91.2	%	25 mM Tris-HCl buffer	8	30°C	5 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Acetonitrile	10%	100.0	12.3	%	25 mM Tris-HCl buffer	8	30°C	5 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Classical aqueous control (in %)

Visualization : Activity — Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate · Scroll to zoom · Right-click drag to pan · Powered by Mol*