Esterase (gene Est40) from Vreelandella sp. CH40
Enzyme Description
Sequence
MSEPGELIIEPKNGQPANACVFILHGLGADGHDFEPLVPALSLPKDANVRFIMPHAPRLAVTINGGMVMPAWYDILAMDLDRRVDEGQLKASAERIQGLIREQMEQGIDSRRIIMAGFSQGGAVAYHATLSFPEPLGGLLALSTYLATADSIELADANRDIEIEVHHGNFDPVVPESLGRSGADRLKGLGYSVNYRQYPMAHALCPQQVSDIGQWLTQRLS
Jiaxuan Lv et al. (2025)
β Optimization, purification and characterization of an intracellular salt-tolerant esterase Est40 from Vreelandella sp. CH40
Archives of Microbiology
Β· doi:10.1007/s00203-025-04387-z β
Β· Activity - Classical
▼
Database ID
UniParc: UPI003A65352F β
Sequence Annotation
Explicit - Provided
Protein Source
Purified, bacterium Vreelandella sp. CH40
Experimental Data (16 measurements)
16 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Methanol | 15% | 100.0 | 40.43 | % | 20 mM phosphate buffer | 8 | 37Β°C | 0.45 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Methanol | 30% | 100.0 | 27.62 | % | 20 mM phosphate buffer | 8 | 37Β°C | 0.45 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Acetonitrile | 15% | 100.0 | 74.05 | % | 20 mM phosphate buffer | 8 | 37Β°C | 0.45 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Acetonitrile | 30% | 100.0 | 52.4 | % | 20 mM phosphate buffer | 8 | 37Β°C | 0.45 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Ethanol | 15% | 100.0 | 94.85 | % | 20 mM phosphate buffer | 8 | 37Β°C | 0.45 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Ethanol | 30% | 100.0 | 59.4 | % | 20 mM phosphate buffer | 8 | 37Β°C | 0.45 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Ethyl Acetate | 15% | 100.0 | 6.65 | % | 20 mM phosphate buffer | 8 | 37Β°C | 0.45 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Ethyl Acetate | 30% | 100.0 | 4.49 | % | 20 mM phosphate buffer | 8 | 37Β°C | 0.45 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Acetone | 15% | 100.0 | 52.09 | % | 20 mM phosphate buffer | 8 | 37Β°C | 0.45 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Acetone | 30% | 100.0 | 38.8 | % | 20 mM phosphate buffer | 8 | 37Β°C | 0.45 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 15% | 100.0 | 122.78 | % | 20 mM phosphate buffer | 8 | 37Β°C | 0.45 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 30% | 100.0 | 101.48 | % | 20 mM phosphate buffer | 8 | 37Β°C | 0.45 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Isopropanol | 15% | 100.0 | 93.21 | % | 20 mM phosphate buffer | 8 | 37Β°C | 0.45 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Isopropanol | 30% | 100.0 | 59.38 | % | 20 mM phosphate buffer | 8 | 37Β°C | 0.45 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Isooctane | 15% | 100.0 | 89.41 | % | 20 mM phosphate buffer | 8 | 37Β°C | 0.45 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Isooctane | 30% | 100.0 | 52.1 | % | 20 mM phosphate buffer | 8 | 37Β°C | 0.45 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
Visualization : Activity β Classical
One bar per measurement. Colour = solvent, shade = solvent volume.