Esterase (gene Est40) from Vreelandella sp. CH40

Enzyme Description

Extremophile
Yes "halophilic" organism
EC Number

Sequence

Length: 221 amino acids
MSEPGELIIEPKNGQPANACVFILHGLGADGHDFEPLVPALSLPKDANVRFIMPHAPRLAVTINGGMVMPAWYDILAMDLDRRVDEGQLKASAERIQGLIREQMEQGIDSRRIIMAGFSQGGAVAYHATLSFPEPLGGLLALSTYLATADSIELADANRDIEIEVHHGNFDPVVPESLGRSGADRLKGLGYSVNYRQYPMAHALCPQQVSDIGQWLTQRLS
Jiaxuan Lv et al. (2025) β€” Optimization, purification and characterization of an intracellular salt-tolerant esterase Est40 from Vreelandella sp. CH40
Archives of Microbiology  Β· doi:10.1007/s00203-025-04387-z β†—  Β· Activity - Classical
16 measurements
Database ID
Sequence Annotation
Explicit - Provided
Protein Source
Purified, bacterium Vreelandella sp. CH40

Experimental Data (16 measurements)

16 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Methanol 15% 100.0 40.43 % 20 mM phosphate buffer 8 37Β°C 0.45 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Methanol 30% 100.0 27.62 % 20 mM phosphate buffer 8 37Β°C 0.45 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Acetonitrile 15% 100.0 74.05 % 20 mM phosphate buffer 8 37Β°C 0.45 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Acetonitrile 30% 100.0 52.4 % 20 mM phosphate buffer 8 37Β°C 0.45 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Ethanol 15% 100.0 94.85 % 20 mM phosphate buffer 8 37Β°C 0.45 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Ethanol 30% 100.0 59.4 % 20 mM phosphate buffer 8 37Β°C 0.45 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Ethyl Acetate 15% 100.0 6.65 % 20 mM phosphate buffer 8 37Β°C 0.45 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Ethyl Acetate 30% 100.0 4.49 % 20 mM phosphate buffer 8 37Β°C 0.45 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Acetone 15% 100.0 52.09 % 20 mM phosphate buffer 8 37Β°C 0.45 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Acetone 30% 100.0 38.8 % 20 mM phosphate buffer 8 37Β°C 0.45 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 15% 100.0 122.78 % 20 mM phosphate buffer 8 37Β°C 0.45 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 30% 100.0 101.48 % 20 mM phosphate buffer 8 37Β°C 0.45 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Isopropanol 15% 100.0 93.21 % 20 mM phosphate buffer 8 37Β°C 0.45 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Isopropanol 30% 100.0 59.38 % 20 mM phosphate buffer 8 37Β°C 0.45 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Isooctane 15% 100.0 89.41 % 20 mM phosphate buffer 8 37Β°C 0.45 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Isooctane 30% 100.0 52.1 % 20 mM phosphate buffer 8 37Β°C 0.45 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*