β-glucosidase (gene RpBgl8) from Reticulitermes perilucifugu

Enzyme Description

Species

Extremophile

EC Number

3.2.1.21 ↗

Sequence

Length: 476 amino acids

MSALKFPPGFLFGSATSAYQVEGAWNEDGKSDSIWDRLTHDHPEIIKDKSSGDVACNSYHLYKEDVRILKELGVHFYRFSVSWTRILPTGYDNVVNQAGIDYYNNLINELIANGIQPMITMYHFDLPQPLQNLGGWTNPVIANYFEDYARVLYANFGDRVKWWNTINEPKTVALGYSAPFGLAPHVLTPGHGQYLVIHTILLSHARAYRLYEREFKDKQGGKVSIVASCQWIEPTTDSKEEEDAAERARQINLGWELHPIYSADGDYPPVMKQWISKKSKEEGYSRSRLPSFTKEEIELVRGTWDYLALNTYTTFFVRQSDEDSVFLSDTGVVSIPNDKYATASSEWLQVVPWGFRKLLNWIAKEYNNPPVLITENGFSDHGEINDTDRINFYITYLCELLKATKENGCNVIGYTAWSMMDNYEWRSGYTEKFGLFHVDFNDPDRKRTAKKSARVFSQIIKSNAIPVEFLAVETSH

Guotao Mao et al. (2025) — Biochemical and Structural Characterization of a Highly Glucose-Tolerant β-Glucosidase from the Termite Reticulitermes perilucifugus

International Journal of Molecular Sciences · doi:10.3390/ijms26073118 ↗ · Activity - Classical

17 measurements ▼

Database ID

UniProt: A0A7G5VX36 ↗

Sequence Annotation

Explicit - Provided

Protein Source

Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (17 measurements)

17 measurements

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 408 nm) in the presence of organic solvent	Isopropanol	10%	100	165	%	20 mM phosphate buffer	7	37°C	5 mM p-Nitrophenyl β-D-glucopyranoside	D-Glucose , p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 408 nm) in the presence of organic solvent	Ethanol	20%	100	55	%	20 mM phosphate buffer	7	37°C	5 mM p-Nitrophenyl β-D-glucopyranoside	D-Glucose , p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 408 nm) in the presence of organic solvent	Ethanol	15%	100	96	%	20 mM phosphate buffer	7	37°C	5 mM p-Nitrophenyl β-D-glucopyranoside	D-Glucose , p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 408 nm) in the presence of organic solvent	Ethanol	10%	100	180	%	20 mM phosphate buffer	7	37°C	5 mM p-Nitrophenyl β-D-glucopyranoside	D-Glucose , p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 408 nm) in the presence of organic solvent	Ethanol	5%	100	202	%	20 mM phosphate buffer	7	37°C	5 mM p-Nitrophenyl β-D-glucopyranoside	D-Glucose , p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 408 nm) in the presence of organic solvent	Ethanol	2.5%	100	183	%	20 mM phosphate buffer	7	37°C	5 mM p-Nitrophenyl β-D-glucopyranoside	D-Glucose , p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 408 nm) in the presence of organic solvent	Isopropanol	25%	100	31	%	20 mM phosphate buffer	7	37°C	5 mM p-Nitrophenyl β-D-glucopyranoside	D-Glucose , p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 408 nm) in the presence of organic solvent	Isopropanol	20%	100	51	%	20 mM phosphate buffer	7	37°C	5 mM p-Nitrophenyl β-D-glucopyranoside	D-Glucose , p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 408 nm) in the presence of organic solvent	Isopropanol	15%	100	75	%	20 mM phosphate buffer	7	37°C	5 mM p-Nitrophenyl β-D-glucopyranoside	D-Glucose , p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 408 nm) in the presence of organic solvent	Methanol	2.5%	100	232	%	20 mM phosphate buffer	7	37°C	5 mM p-Nitrophenyl β-D-glucopyranoside	D-Glucose , p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 408 nm) in the presence of organic solvent	Isopropanol	5%	100	168	%	20 mM phosphate buffer	7	37°C	5 mM p-Nitrophenyl β-D-glucopyranoside	D-Glucose , p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 408 nm) in the presence of organic solvent	Isopropanol	2.5%	100	192	%	20 mM phosphate buffer	7	37°C	5 mM p-Nitrophenyl β-D-glucopyranoside	D-Glucose , p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 408 nm) in the presence of organic solvent	Glycerol	5%	100	130	%	20 mM phosphate buffer	7	37°C	5 mM p-Nitrophenyl β-D-glucopyranoside	D-Glucose , p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 408 nm) in the presence of organic solvent	Glycerol	2.5%	100	172	%	20 mM phosphate buffer	7	37°C	5 mM p-Nitrophenyl β-D-glucopyranoside	D-Glucose , p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 408 nm) in the presence of organic solvent	1-Butanol	5%	100	68	%	20 mM phosphate buffer	7	37°C	5 mM p-Nitrophenyl β-D-glucopyranoside	D-Glucose , p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 408 nm) in the presence of organic solvent	1-Butanol	2.5%	100	160	%	20 mM phosphate buffer	7	37°C	5 mM p-Nitrophenyl β-D-glucopyranoside	D-Glucose , p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 408 nm) in the presence of organic solvent	Methanol	5%	100	102	%	20 mM phosphate buffer	7	37°C	5 mM p-Nitrophenyl β-D-glucopyranoside	D-Glucose , p-Nitrophenol	—	—	Classical aqueous control (in %)

Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 408 nm) in the presence of organic solvent	Isopropanol	10%	100	165	%	20 mM phosphate buffer	7	37°C	5 mM p-Nitrophenyl β-D-glucopyranoside	D-Glucose, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 408 nm) in the presence of organic solvent	Ethanol	20%	100	55	%	20 mM phosphate buffer	7	37°C	5 mM p-Nitrophenyl β-D-glucopyranoside	D-Glucose, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 408 nm) in the presence of organic solvent	Ethanol	15%	100	96	%	20 mM phosphate buffer	7	37°C	5 mM p-Nitrophenyl β-D-glucopyranoside	D-Glucose, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 408 nm) in the presence of organic solvent	Ethanol	10%	100	180	%	20 mM phosphate buffer	7	37°C	5 mM p-Nitrophenyl β-D-glucopyranoside	D-Glucose, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 408 nm) in the presence of organic solvent	Ethanol	5%	100	202	%	20 mM phosphate buffer	7	37°C	5 mM p-Nitrophenyl β-D-glucopyranoside	D-Glucose, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 408 nm) in the presence of organic solvent	Ethanol	2.5%	100	183	%	20 mM phosphate buffer	7	37°C	5 mM p-Nitrophenyl β-D-glucopyranoside	D-Glucose, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 408 nm) in the presence of organic solvent	Isopropanol	25%	100	31	%	20 mM phosphate buffer	7	37°C	5 mM p-Nitrophenyl β-D-glucopyranoside	D-Glucose, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 408 nm) in the presence of organic solvent	Isopropanol	20%	100	51	%	20 mM phosphate buffer	7	37°C	5 mM p-Nitrophenyl β-D-glucopyranoside	D-Glucose, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 408 nm) in the presence of organic solvent	Isopropanol	15%	100	75	%	20 mM phosphate buffer	7	37°C	5 mM p-Nitrophenyl β-D-glucopyranoside	D-Glucose, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 408 nm) in the presence of organic solvent	Methanol	2.5%	100	232	%	20 mM phosphate buffer	7	37°C	5 mM p-Nitrophenyl β-D-glucopyranoside	D-Glucose, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 408 nm) in the presence of organic solvent	Isopropanol	5%	100	168	%	20 mM phosphate buffer	7	37°C	5 mM p-Nitrophenyl β-D-glucopyranoside	D-Glucose, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 408 nm) in the presence of organic solvent	Isopropanol	2.5%	100	192	%	20 mM phosphate buffer	7	37°C	5 mM p-Nitrophenyl β-D-glucopyranoside	D-Glucose, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 408 nm) in the presence of organic solvent	Glycerol	5%	100	130	%	20 mM phosphate buffer	7	37°C	5 mM p-Nitrophenyl β-D-glucopyranoside	D-Glucose, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 408 nm) in the presence of organic solvent	Glycerol	2.5%	100	172	%	20 mM phosphate buffer	7	37°C	5 mM p-Nitrophenyl β-D-glucopyranoside	D-Glucose, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 408 nm) in the presence of organic solvent	1-Butanol	5%	100	68	%	20 mM phosphate buffer	7	37°C	5 mM p-Nitrophenyl β-D-glucopyranoside	D-Glucose, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 408 nm) in the presence of organic solvent	1-Butanol	2.5%	100	160	%	20 mM phosphate buffer	7	37°C	5 mM p-Nitrophenyl β-D-glucopyranoside	D-Glucose, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 408 nm) in the presence of organic solvent	Methanol	5%	100	102	%	20 mM phosphate buffer	7	37°C	5 mM p-Nitrophenyl β-D-glucopyranoside	D-Glucose, p-Nitrophenol	—	—	Classical aqueous control (in %)

Visualization : Activity — Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate · Scroll to zoom · Right-click drag to pan · Powered by Mol*