Lipase (gene WJ_23) from Mucor circinelloides WJ11

Enzyme Description

Species
Mucor circinelloides WJ11 β†—
Extremophile
No
EC Number
3.1.1.3 β†—

Sequence

Length: 385 amino acids
MVSFVSISQGISLFFIVSSMLAGPAHAAPASSSHSSHKNATSSDVSTTFTLPPIISSRVTPPKVPSGNHNVEDDNVAKNKKWFEAHGGKLNVTKRADETVGGYTMDLPSNAPPLPAVPSTSTVVIASTAQISEFKKYAGIASTAYCRSVVPLNQWSCTNCLKFVPDGKLIKTFTSLITDTNGFVLRSDAQKTIYVVFRGTNSIRSAITDLVFDLTNYTPVSGAKVHTGFYASYKAVISDYFPAVQSQLTAYPGYKVIVTGHSLGGAQALLAGMDLYQREPRLSKSNLAIYTVGCPRVGNPAFAYYVDSTGITFSRSVNNRDIVPHVPPQAWGFLHPGVEAWARSSSKVQICTPNIETGLCSNSIVPFTSFTDHLTYYDINEGLCL
Yao Zhang et al. (2025) β€” Heterologous expression and enzymatic properties of lipase from Mucor circinelloides
Scientific Reports  Β· doi:10.1038/s41598-025-93938-x β†—  Β· Stability - Incubation
14 measurements ▼
Database ID
β€”
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host yeast Pichia pastoris GS115

Experimental Data (14 measurements)

14 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (18 hours at 20Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Ethanol 50% 100 50 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer Incubation: 9, Assay: 8 Incubation: 20Β°C, Assay: 40Β°C 0.25 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (18 hours at 20Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Ethanol 75% 100 45 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer Incubation: 9, Assay: 8 Incubation: 20Β°C, Assay: 40Β°C 0.25 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (18 hours at 20Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase 1-Butanol 50% 100 102 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer Incubation: 9, Assay: 8 Incubation: 20Β°C, Assay: 40Β°C 0.25 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (18 hours at 20Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase 1-Butanol 75% 100 101 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer Incubation: 9, Assay: 8 Incubation: 20Β°C, Assay: 40Β°C 0.25 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (18 hours at 20Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Isooctane 50% 100 95 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer Incubation: 9, Assay: 8 Incubation: 20Β°C, Assay: 40Β°C 0.25 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (18 hours at 20Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Isooctane 75% 100 94 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer Incubation: 9, Assay: 8 Incubation: 20Β°C, Assay: 40Β°C 0.25 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (18 hours at 20Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Methanol 50% 100 80 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer Incubation: 9, Assay: 8 Incubation: 20Β°C, Assay: 40Β°C 0.25 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (18 hours at 20Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Methanol 75% 100 78 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer Incubation: 9, Assay: 8 Incubation: 20Β°C, Assay: 40Β°C 0.25 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (18 hours at 20Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase 1-Propanol 50% 100 85 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer Incubation: 9, Assay: 8 Incubation: 20Β°C, Assay: 40Β°C 0.25 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (18 hours at 20Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase 1-Propanol 75% 100 82 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer Incubation: 9, Assay: 8 Incubation: 20Β°C, Assay: 40Β°C 0.25 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (18 hours at 20Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Dichloromethane 50% 100 92 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer Incubation: 9, Assay: 8 Incubation: 20Β°C, Assay: 40Β°C 0.25 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (18 hours at 20Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Dichloromethane 75% 100 90 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer Incubation: 9, Assay: 8 Incubation: 20Β°C, Assay: 40Β°C 0.25 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (18 hours at 20Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Glycerol 50% 100 104 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer Incubation: 9, Assay: 8 Incubation: 20Β°C, Assay: 40Β°C 0.25 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (18 hours at 20Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Glycerol 75% 100 101 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer Incubation: 9, Assay: 8 Incubation: 20Β°C, Assay: 40Β°C 0.25 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*