Laccase from Geobacillus thermocatenulatus M17
Enzyme Description
Extremophile
Yes
"thermophilic" organism
EC Number
Sequence
MSDIFQQEARGWLRCGAPPFAGAVAGLTTKHGGESKGPFASLNMGLHVGDDRTDVVNNRRRLAEWLAFPLERWVCCEQVHGADIQKVTKSDRGNGAQDFATAVLGVDGLYTDEAEVLLALCFADCVPIYFVAPSAGLVGLAHAGWRGTAGGIAGHNVRLWQTREHIAPSDIYVAIGPAIGPCCYTVDDRVVDSLRPTLPPESPLPWRETSPGQYALDLKEANRLQLLAAGVPNSHIYVSERCTSCEEALFFSHRRDRGTTGRMLAFIGRREEWT
Bohan Sun et al. (2025)
β Characterization and rational engineering of a novel laccase from Geobacillus thermocatenulatus M17 for improved lignin degradation activity
International Journal of Biological Macromolecules
Β· doi:10.1016/j.ijbiomac.2024.138856 β
Β· Activity - Classical
▼
Database ID
β
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (15 measurements)
15 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in the presence of organic solvent | Methanol | 10% | 100.0 | 123.93 | % | 100 mM citric acidβsodium dihydrogen phosphate buffer | 3 | 50Β°C | ? mM ABTS | ABTS radical cation | β | β | Classical aqueous control (in %) | Uncertainty about assay conditions and subtrate : deducted as optimal ones |
| Activity - Classical | Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in the presence of organic solvent | Methanol | 20% | 100.0 | 114.51 | % | 100 mM citric acidβsodium dihydrogen phosphate buffer | 3 | 50Β°C | ? mM ABTS | ABTS radical cation | β | β | Classical aqueous control (in %) | Uncertainty about assay conditions and subtrate : deducted as optimal ones |
| Activity - Classical | Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in the presence of organic solvent | Methanol | 30% | 100.0 | 66.92 | % | 100 mM citric acidβsodium dihydrogen phosphate buffer | 3 | 50Β°C | ? mM ABTS | ABTS radical cation | β | β | Classical aqueous control (in %) | Uncertainty about assay conditions and subtrate : deducted as optimal ones |
| Activity - Classical | Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in the presence of organic solvent | Ethanol | 10% | 100.0 | 125.23 | % | 100 mM citric acidβsodium dihydrogen phosphate buffer | 3 | 50Β°C | ? mM ABTS | ABTS radical cation | β | β | Classical aqueous control (in %) | Uncertainty about assay conditions and subtrate : deducted as optimal ones |
| Activity - Classical | Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in the presence of organic solvent | Ethanol | 20% | 100.0 | 105.83 | % | 100 mM citric acidβsodium dihydrogen phosphate buffer | 3 | 50Β°C | ? mM ABTS | ABTS radical cation | β | β | Classical aqueous control (in %) | Uncertainty about assay conditions and subtrate : deducted as optimal ones |
| Activity - Classical | Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in the presence of organic solvent | Ethanol | 30% | 100.0 | 51.83 | % | 100 mM citric acidβsodium dihydrogen phosphate buffer | 3 | 50Β°C | ? mM ABTS | ABTS radical cation | β | β | Classical aqueous control (in %) | Uncertainty about assay conditions and subtrate : deducted as optimal ones |
| Activity - Classical | Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in the presence of organic solvent | Isopropanol | 10% | 100.0 | 128.93 | % | 100 mM citric acidβsodium dihydrogen phosphate buffer | 3 | 50Β°C | ? mM ABTS | ABTS radical cation | β | β | Classical aqueous control (in %) | Uncertainty about assay conditions and subtrate : deducted as optimal ones |
| Activity - Classical | Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in the presence of organic solvent | Isopropanol | 20% | 100.0 | 75.69 | % | 100 mM citric acidβsodium dihydrogen phosphate buffer | 3 | 50Β°C | ? mM ABTS | ABTS radical cation | β | β | Classical aqueous control (in %) | Uncertainty about assay conditions and subtrate : deducted as optimal ones |
| Activity - Classical | Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in the presence of organic solvent | Isopropanol | 30% | 100.0 | 22.13 | % | 100 mM citric acidβsodium dihydrogen phosphate buffer | 3 | 50Β°C | ? mM ABTS | ABTS radical cation | β | β | Classical aqueous control (in %) | Uncertainty about assay conditions and subtrate : deducted as optimal ones |
| Activity - Classical | Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in the presence of organic solvent | 1-Butanol | 10% | 100.0 | 110.58 | % | 100 mM citric acidβsodium dihydrogen phosphate buffer | 3 | 50Β°C | ? mM ABTS | ABTS radical cation | β | β | Classical aqueous control (in %) | Uncertainty about assay conditions and subtrate : deducted as optimal ones |
| Activity - Classical | Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in the presence of organic solvent | 1-Butanol | 20% | 100.0 | 41.89 | % | 100 mM citric acidβsodium dihydrogen phosphate buffer | 3 | 50Β°C | ? mM ABTS | ABTS radical cation | β | β | Classical aqueous control (in %) | Uncertainty about assay conditions and subtrate : deducted as optimal ones |
| Activity - Classical | Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in the presence of organic solvent | 1-Butanol | 30% | 100.0 | 20.27 | % | 100 mM citric acidβsodium dihydrogen phosphate buffer | 3 | 50Β°C | ? mM ABTS | ABTS radical cation | β | β | Classical aqueous control (in %) | Uncertainty about assay conditions and subtrate : deducted as optimal ones |
| Activity - Classical | Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 10% | 100.0 | 131.63 | % | 100 mM citric acidβsodium dihydrogen phosphate buffer | 3 | 50Β°C | ? mM ABTS | ABTS radical cation | β | β | Classical aqueous control (in %) | Uncertainty about assay conditions and subtrate : deducted as optimal ones |
| Activity - Classical | Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 20% | 100.0 | 111.75 | % | 100 mM citric acidβsodium dihydrogen phosphate buffer | 3 | 50Β°C | ? mM ABTS | ABTS radical cation | β | β | Classical aqueous control (in %) | Uncertainty about assay conditions and subtrate : deducted as optimal ones |
| Activity - Classical | Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 30% | 100.0 | 73.49 | % | 100 mM citric acidβsodium dihydrogen phosphate buffer | 3 | 50Β°C | ? mM ABTS | ABTS radical cation | β | β | Classical aqueous control (in %) | Uncertainty about assay conditions and subtrate : deducted as optimal ones |
Visualization : Activity β Classical
One bar per measurement. Colour = solvent, shade = solvent volume.