Esterase (gene Est13) from Bacillus subtilis J6

Enzyme Description

Species
Bacillus subtilis J6 β†—
Extremophile
No but"cold-adapted" enzyme
EC Number
3.1.1.1 β†—

Sequence

Length: 246 amino acids
MKIVTPKPFTFKGGDKAVLLLHGFTGNTADVRMLGRYLNERGYTCHAPQYKGHGVPPEELVHTGPEDWWKDVMDGYEYLRSEGYENIAACGLSLGGVFSLKLGYTVPIKGIVPMCAPMHIKSEEVMYEGVLSYARNYKKFEGKQPEQIEKEMKEFEKTPMNTLKSLQELIADVRKNVDMIYSPTFVVQARHDHMINTESANIIFNEVETDDKQLKWYEESGHVITLDKERDLVHQDVYEFLEKLDW
Mengmei Zhang et al. (2024) β€” A novel cold-adapted pyrethroid-degrading esterase from Bacillus subtilis J6 and its application for pyrethroid-residual alleviation in food matrix
Journal of Hazardous Materials  Β· doi:10.1016/j.jhazmat.2023.132847 β†—  Β· Activity - Classical
16 measurements ▼
Database ID
β€”
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (16 measurements)

16 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by HPLC (cypermethrin disappearance measurement after 1 hour incubation at 25Β°C) in the presence of organic solvent Methanol 2% 100.0 96.2 % 20 mM Tris-HCl buffer 7 25Β°C 10 Β΅gram/ml Ξ²-Cypermethrin Beta-Cypermethrin hydrolysis products β€” β€” Classical aqueous control (in %) | Possibility it's a "pre-incubation" assay, not very clear
Activity - Classical Activity measured by HPLC (cypermethrin disappearance measurement after 1 hour incubation at 25Β°C) in the presence of organic solvent Acetonitrile 2% 100.0 93.14 % 20 mM Tris-HCl buffer 7 25Β°C 10 Β΅gram/ml Ξ²-Cypermethrin Beta-Cypermethrin hydrolysis products β€” β€” Classical aqueous control (in %) | Possibility it's a "pre-incubation" assay, not very clear
Activity - Classical Activity measured by HPLC (cypermethrin disappearance measurement after 1 hour incubation at 25Β°C) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 2% 100.0 105.5 % 20 mM Tris-HCl buffer 7 25Β°C 10 Β΅gram/ml Ξ²-Cypermethrin Beta-Cypermethrin hydrolysis products β€” β€” Classical aqueous control (in %) | Possibility it's a "pre-incubation" assay, not very clear
Activity - Classical Activity measured by HPLC (cypermethrin disappearance measurement after 1 hour incubation at 25Β°C) in the presence of organic solvent Ethanol 2% 100.0 101.19 % 20 mM Tris-HCl buffer 7 25Β°C 10 Β΅gram/ml Ξ²-Cypermethrin Beta-Cypermethrin hydrolysis products β€” β€” Classical aqueous control (in %) | Possibility it's a "pre-incubation" assay, not very clear
Activity - Classical Activity measured by HPLC (cypermethrin disappearance measurement after 1 hour incubation at 25Β°C) in the presence of organic solvent Isopropanol 2% 100.0 98.11 % 20 mM Tris-HCl buffer 7 25Β°C 10 Β΅gram/ml Ξ²-Cypermethrin Beta-Cypermethrin hydrolysis products β€” β€” Classical aqueous control (in %) | Possibility it's a "pre-incubation" assay, not very clear
Activity - Classical Activity measured by HPLC (cypermethrin disappearance measurement after 1 hour incubation at 25Β°C) in the presence of organic solvent Chloroform 2% 100.0 76.27 % 20 mM Tris-HCl buffer 7 25Β°C 10 Β΅gram/ml Ξ²-Cypermethrin Beta-Cypermethrin hydrolysis products β€” β€” Classical aqueous control (in %) | Possibility it's a "pre-incubation" assay, not very clear
Activity - Classical Activity measured by HPLC (cypermethrin disappearance measurement after 1 hour incubation at 25Β°C) in the presence of organic solvent Acetone 2% 100.0 100.78 % 20 mM Tris-HCl buffer 7 25Β°C 10 Β΅gram/ml Ξ²-Cypermethrin Beta-Cypermethrin hydrolysis products β€” β€” Classical aqueous control (in %) | Possibility it's a "pre-incubation" assay, not very clear
Activity - Classical Activity measured by HPLC (cypermethrin disappearance measurement after 1 hour incubation at 25Β°C) in the presence of organic solvent Petroleum Ether 2% 100.0 97.03 % 20 mM Tris-HCl buffer 7 25Β°C 10 Β΅gram/ml Ξ²-Cypermethrin Beta-Cypermethrin hydrolysis products β€” β€” Classical aqueous control (in %) | Possibility it's a "pre-incubation" assay, not very clear
Activity - Classical Activity measured by HPLC (cypermethrin disappearance measurement after 1 hour incubation at 25Β°C) in the presence of organic solvent Methanol 5% 100.0 90.45 % 20 mM Tris-HCl buffer 7 25Β°C 10 Β΅gram/ml Ξ²-Cypermethrin Beta-Cypermethrin hydrolysis products β€” β€” Classical aqueous control (in %) | Possibility it's a "pre-incubation" assay, not very clear
Activity - Classical Activity measured by HPLC (cypermethrin disappearance measurement after 1 hour incubation at 25Β°C) in the presence of organic solvent Acetonitrile 5% 100.0 78.7 % 20 mM Tris-HCl buffer 7 25Β°C 10 Β΅gram/ml Ξ²-Cypermethrin Beta-Cypermethrin hydrolysis products β€” β€” Classical aqueous control (in %) | Possibility it's a "pre-incubation" assay, not very clear
Activity - Classical Activity measured by HPLC (cypermethrin disappearance measurement after 1 hour incubation at 25Β°C) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 5% 100.0 91.87 % 20 mM Tris-HCl buffer 7 25Β°C 10 Β΅gram/ml Ξ²-Cypermethrin Beta-Cypermethrin hydrolysis products β€” β€” Classical aqueous control (in %) | Possibility it's a "pre-incubation" assay, not very clear
Activity - Classical Activity measured by HPLC (cypermethrin disappearance measurement after 1 hour incubation at 25Β°C) in the presence of organic solvent Ethanol 5% 100.0 88.25 % 20 mM Tris-HCl buffer 7 25Β°C 10 Β΅gram/ml Ξ²-Cypermethrin Beta-Cypermethrin hydrolysis products β€” β€” Classical aqueous control (in %) | Possibility it's a "pre-incubation" assay, not very clear
Activity - Classical Activity measured by HPLC (cypermethrin disappearance measurement after 1 hour incubation at 25Β°C) in the presence of organic solvent Isopropanol 5% 100.0 83.97 % 20 mM Tris-HCl buffer 7 25Β°C 10 Β΅gram/ml Ξ²-Cypermethrin Beta-Cypermethrin hydrolysis products β€” β€” Classical aqueous control (in %) | Possibility it's a "pre-incubation" assay, not very clear
Activity - Classical Activity measured by HPLC (cypermethrin disappearance measurement after 1 hour incubation at 25Β°C) in the presence of organic solvent Chloroform 5% 100.0 31.63 % 20 mM Tris-HCl buffer 7 25Β°C 10 Β΅gram/ml Ξ²-Cypermethrin Beta-Cypermethrin hydrolysis products β€” β€” Classical aqueous control (in %) | Possibility it's a "pre-incubation" assay, not very clear
Activity - Classical Activity measured by HPLC (cypermethrin disappearance measurement after 1 hour incubation at 25Β°C) in the presence of organic solvent Acetone 5% 100.0 88.8 % 20 mM Tris-HCl buffer 7 25Β°C 10 Β΅gram/ml Ξ²-Cypermethrin Beta-Cypermethrin hydrolysis products β€” β€” Classical aqueous control (in %) | Possibility it's a "pre-incubation" assay, not very clear
Activity - Classical Activity measured by HPLC (cypermethrin disappearance measurement after 1 hour incubation at 25Β°C) in the presence of organic solvent Petroleum Ether 5% 100.0 107.14 % 20 mM Tris-HCl buffer 7 25Β°C 10 Β΅gram/ml Ξ²-Cypermethrin Beta-Cypermethrin hydrolysis products β€” β€” Classical aqueous control (in %) | Possibility it's a "pre-incubation" assay, not very clear

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*