Metalloprotease (gene nprB) from Streptomyces thermovulgaris NBRC 12383

Enzyme Description

Species
Streptomyces thermovulgaris NBRC 12383 β†—
Extremophile
Yes thermophilic organism
EC Number
3.4.24.- β†—

Sequence

Length: 178 amino acids
MRNLTKTSLLLAGLCTAAQMFFVTPASADQSIKYDHTYQTPSYIIEKSPQKPAQNTTQKEALFSYLDEHQTHFKLKGNANSHFRVSKTIKDPKTKQTFFKLTEVYKGIPIYGFEQAVAMKENKQVKSFFGKVHPQIKDVSVTPSISEKKAIHTARRELEASIGKIEYLDGEPKGELYI
Amna Mushtaq et al. (2024) β€” Cloning, Expression, and Characterization of a Metalloprotease from Thermophilic Bacterium Streptomyces thermovulgaris
Biology  Β· doi:10.3390/biology13080619 β†—  Β· Activity - Classical
7 measurements ▼
Database ID
UniProt: A0A1P8YZB9 β†—
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (7 measurements)

7 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosine residues absorbance measurement, 280 & 660 nm) in the presence of organic solvent Ethanol 10% 100.0 90.5 % 50 mM potassium phosphate buffer 7.2 70Β°C 0.5% Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosine residues absorbance measurement, 280 & 660 nm) in the presence of organic solvent Methanol 10% 100.0 95.4 % 50 mM potassium phosphate buffer 7.2 70Β°C 0.5% Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosine residues absorbance measurement, 280 & 660 nm) in the presence of organic solvent n-Hexane 10% 100.0 91.5 % 50 mM potassium phosphate buffer 7.2 70Β°C 0.5% Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosine residues absorbance measurement, 280 & 660 nm) in the presence of organic solvent Benzene 10% 100.0 105.0 % 50 mM potassium phosphate buffer 7.2 70Β°C 0.5% Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosine residues absorbance measurement, 280 & 660 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 10% 100.0 80.0 % 50 mM potassium phosphate buffer 7.2 70Β°C 0.5% Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosine residues absorbance measurement, 280 & 660 nm) in the presence of organic solvent Chloroform 10% 100.0 105.0 % 50 mM potassium phosphate buffer 7.2 70Β°C 0.5% Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosine residues absorbance measurement, 280 & 660 nm) in the presence of organic solvent Toluene 10% 100.0 88.0 % 50 mM potassium phosphate buffer 7.2 70Β°C 0.5% Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*