Laccase 1 (gene lcc1) from Trametes trogii
Enzyme Description
Sequence
MARFQSLLTFITLSLVASVYAAIGPVADLTISNGAVSPDGFSRQAILVNDVFPSPLITGNKGDRFQLNVIDNMTNHTMLKSTSIHWHGFFQHGTNWADGPAFVNQCPISTGHAFLYDFQVPDQAGTFWYHSHLSTQYCDGLRGPIVVYDPQDPHKSLYDVDDDSTVITLADWYHLAAKVGSPVPTADATLINGLGRSIDTLNADLAVITVTKGKRYRFRLVSLSCDPNHVFSIDGHSLTVIEADSVNLKPQTVDSIQIFAAQRYSFVLNADQDVGNYWIRALPNSGTRNFDGGVNSAILRYDGAAPVEPTTSQTPSTNPLVESALTTLEGTAAPGSPAPGGVDLALNMAFGFAGGKFTINGASFTPPTVPVLLQILSGAQSAQDLLPSGSVYSLPANADIEISLPATAAAPGFPHPFHLHGHTFAVVRSAGSSTYNYENPVYRDVVSTGSPGDNVTIRFRTDNPGPWFLHCHIDFHLEAGFAVVMAEDIPEVAATNPVPQAWSDLCPTYDALSPDDQ
Xiaofei Song et al. (2024)
β Decolorization and detoxication of malachite green by engineered Saccharomyces cerevisiae expressing novel thermostable laccase from Trametes trogii
Bioresource Technology
Β· doi:10.1016/j.biortech.2024.130591 β
Β· Stability - Incubation
▼
Database ID
UniProt: Q9HDQ0 β
Sequence Annotation
Inferred - from protein name
Protein Source
Recombinant, host yeast Saccharomyces cerevisiae 1447
Experimental Data (5 measurements)
5 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (1 hour at ?Β°C), measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in aqueous phase | Ethanol | 30% | 100 | 88 | % | Incubation: ?, Assay: ? mM citrate buffer | Incubation: ?, Assay: 2.4 | Incubation: ?, Assay: 50Β°C | ABTS diammonium salt, HβOβ (Hydrogen Peroxide) | ABTS radical cation diammonium salt | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about protein sequence, uncertainty about whether assay really was in aqueous phase, uncertainty about control |
| Stability - Incubation | Activity after incubation (1 hour at ?Β°C), measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 30% | 100 | 77 | % | Incubation: ?, Assay: ? mM citrate buffer | Incubation: ?, Assay: 2.4 | Incubation: ?, Assay: 50Β°C | ABTS diammonium salt, HβOβ (Hydrogen Peroxide) | ABTS radical cation diammonium salt | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about protein sequence, uncertainty about whether assay really was in aqueous phase, uncertainty about control |
| Stability - Incubation | Activity after incubation (1 hour at ?Β°C), measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in aqueous phase | Methanol | 30% | 100 | 88 | % | Incubation: ?, Assay: ? mM citrate buffer | Incubation: ?, Assay: 2.4 | Incubation: ?, Assay: 50Β°C | ABTS diammonium salt, HβOβ (Hydrogen Peroxide) | ABTS radical cation diammonium salt | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about protein sequence, uncertainty about whether assay really was in aqueous phase, uncertainty about control |
| Stability - Incubation | Activity after incubation (1 hour at ?Β°C), measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in aqueous phase | Acetone | 30% | 100 | 78 | % | Incubation: ?, Assay: ? mM citrate buffer | Incubation: ?, Assay: 2.4 | Incubation: ?, Assay: 50Β°C | ABTS diammonium salt, HβOβ (Hydrogen Peroxide) | ABTS radical cation diammonium salt | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about protein sequence, uncertainty about whether assay really was in aqueous phase, uncertainty about control |
| Stability - Incubation | Activity after incubation (1 hour at ?Β°C), measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in aqueous phase | Isopropanol | 30% | 100 | 70 | % | Incubation: ?, Assay: ? mM citrate buffer | Incubation: ?, Assay: 2.4 | Incubation: ?, Assay: 50Β°C | ABTS diammonium salt, HβOβ (Hydrogen Peroxide) | ABTS radical cation diammonium salt | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about protein sequence, uncertainty about whether assay really was in aqueous phase, uncertainty about control |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.