Lipase (gene Lac-Rh) from Lacticaseibacillus rhamnosus IDCC 3201

Enzyme Description

Extremophile
No but "thermostable" enzyme
EC Number

Sequence

Length: 212 amino acids
MLGDSLTYGVGDATNNGGFVGLTKGELEATGQYQVTTKNYGVSGNTSGQILTRVNKQPKIRADLKRANIITVTAGGNDLMHVLQKHFLTLSEKQVTAGSVAFQKRLATLLTTIRKENPTAPIYVFGIYNPFYVYFPKMTAMTNSVKAWNQATQKTLQQFDRTYYVDIDSVLSNGETAANKASAKEALKEATSGDGNPLIFSQDHFHPNNAGY
Mi Dan Kang et al. (2024) β€” A lipase from Lacticaseibacillus rhamnosus IDCC 3201 with thermostability and pH resistance for use as a detergent additive
Applied Microbiology and Biotechnology  Β· doi:10.1007/s00253-024-13185-4 β†—  Β· Stability - Incubation
20 measurements
Database ID
β€”
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (20 measurements)

20 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (1 hour at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Acetonitrile 10% 100.0 100.6 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM potassium phosphate buffer, 1 mg/ml gum arabic, 2% Triton X-100, 2 mg/ml sodium deoxycholate, ? % isopropanol Incubation: 8, Assay: 8 Incubation: Room temperature, Assay: 60Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Conflicting temperature legend main text, uncertainty about whether assay was really in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Butyl Acetate 30% 100.0 0.0 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM potassium phosphate buffer, 1 mg/ml gum arabic, 2% Triton X-100, 2 mg/ml sodium deoxycholate, ? % isopropanol Incubation: 8, Assay: 8 Incubation: Room temperature, Assay: 60Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Conflicting temperature legend main text, uncertainty about whether assay was really in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Butyl Acetate 10% 100.0 19.1 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM potassium phosphate buffer, 1 mg/ml gum arabic, 2% Triton X-100, 2 mg/ml sodium deoxycholate, ? % isopropanol Incubation: 8, Assay: 8 Incubation: Room temperature, Assay: 60Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Conflicting temperature legend main text, uncertainty about whether assay was really in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase n-Hexane 30% 100.0 24.4 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM potassium phosphate buffer, 1 mg/ml gum arabic, 2% Triton X-100, 2 mg/ml sodium deoxycholate, ? % isopropanol Incubation: 8, Assay: 8 Incubation: Room temperature, Assay: 60Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Conflicting temperature legend main text, uncertainty about whether assay was really in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase n-Hexane 10% 100.0 34.7 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM potassium phosphate buffer, 1 mg/ml gum arabic, 2% Triton X-100, 2 mg/ml sodium deoxycholate, ? % isopropanol Incubation: 8, Assay: 8 Incubation: Room temperature, Assay: 60Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Conflicting temperature legend main text, uncertainty about whether assay was really in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Ethyl Acetate 30% 100.0 0.0 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM potassium phosphate buffer, 1 mg/ml gum arabic, 2% Triton X-100, 2 mg/ml sodium deoxycholate, ? % isopropanol Incubation: 8, Assay: 8 Incubation: Room temperature, Assay: 60Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Conflicting temperature legend main text, uncertainty about whether assay was really in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Ethyl Acetate 10% 100.0 32.9 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM potassium phosphate buffer, 1 mg/ml gum arabic, 2% Triton X-100, 2 mg/ml sodium deoxycholate, ? % isopropanol Incubation: 8, Assay: 8 Incubation: Room temperature, Assay: 60Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Conflicting temperature legend main text, uncertainty about whether assay was really in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Isopropanol 30% 100.0 61.5 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM potassium phosphate buffer, 1 mg/ml gum arabic, 2% Triton X-100, 2 mg/ml sodium deoxycholate, ? % isopropanol Incubation: 8, Assay: 8 Incubation: Room temperature, Assay: 60Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Conflicting temperature legend main text, uncertainty about whether assay was really in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Isopropanol 10% 100.0 105.0 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM potassium phosphate buffer, 1 mg/ml gum arabic, 2% Triton X-100, 2 mg/ml sodium deoxycholate, ? % isopropanol Incubation: 8, Assay: 8 Incubation: Room temperature, Assay: 60Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Conflicting temperature legend main text, uncertainty about whether assay was really in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Acetonitrile 30% 100.0 56.8 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM potassium phosphate buffer, 1 mg/ml gum arabic, 2% Triton X-100, 2 mg/ml sodium deoxycholate, ? % isopropanol Incubation: 8, Assay: 8 Incubation: Room temperature, Assay: 60Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Conflicting temperature legend main text, uncertainty about whether assay was really in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Acetone 10% 100.0 109.4 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM potassium phosphate buffer, 1 mg/ml gum arabic, 2% Triton X-100, 2 mg/ml sodium deoxycholate, ? % isopropanol Incubation: 8, Assay: 8 Incubation: Room temperature, Assay: 60Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Conflicting temperature legend main text, uncertainty about whether assay was really in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Ethanol 30% 100.0 75.3 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM potassium phosphate buffer, 1 mg/ml gum arabic, 2% Triton X-100, 2 mg/ml sodium deoxycholate, ? % isopropanol Incubation: 8, Assay: 8 Incubation: Room temperature, Assay: 60Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Conflicting temperature legend main text, uncertainty about whether assay was really in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Ethanol 10% 100.0 93.5 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM potassium phosphate buffer, 1 mg/ml gum arabic, 2% Triton X-100, 2 mg/ml sodium deoxycholate, ? % isopropanol Incubation: 8, Assay: 8 Incubation: Room temperature, Assay: 60Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Conflicting temperature legend main text, uncertainty about whether assay was really in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Methanol 30% 100.0 61.5 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM potassium phosphate buffer, 1 mg/ml gum arabic, 2% Triton X-100, 2 mg/ml sodium deoxycholate, ? % isopropanol Incubation: 8, Assay: 8 Incubation: Room temperature, Assay: 60Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Conflicting temperature legend main text, uncertainty about whether assay was really in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Methanol 10% 100.0 107.6 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM potassium phosphate buffer, 1 mg/ml gum arabic, 2% Triton X-100, 2 mg/ml sodium deoxycholate, ? % isopropanol Incubation: 8, Assay: 8 Incubation: Room temperature, Assay: 60Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Conflicting temperature legend main text, uncertainty about whether assay was really in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 30% 100.0 97.6 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM potassium phosphate buffer, 1 mg/ml gum arabic, 2% Triton X-100, 2 mg/ml sodium deoxycholate, ? % isopropanol Incubation: 8, Assay: 8 Incubation: Room temperature, Assay: 60Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Conflicting temperature legend main text, uncertainty about whether assay was really in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 10% 100.0 126.8 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM potassium phosphate buffer, 1 mg/ml gum arabic, 2% Triton X-100, 2 mg/ml sodium deoxycholate, ? % isopropanol Incubation: 8, Assay: 8 Incubation: Room temperature, Assay: 60Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Conflicting temperature legend main text, uncertainty about whether assay was really in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Glycerol 30% 100.0 81.8 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM potassium phosphate buffer, 1 mg/ml gum arabic, 2% Triton X-100, 2 mg/ml sodium deoxycholate, ? % isopropanol Incubation: 8, Assay: 8 Incubation: Room temperature, Assay: 60Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Conflicting temperature legend main text, uncertainty about whether assay was really in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Glycerol 10% 100.0 137.0 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM potassium phosphate buffer, 1 mg/ml gum arabic, 2% Triton X-100, 2 mg/ml sodium deoxycholate, ? % isopropanol Incubation: 8, Assay: 8 Incubation: Room temperature, Assay: 60Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Conflicting temperature legend main text, uncertainty about whether assay was really in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Acetone 30% 100.0 65.9 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM potassium phosphate buffer, 1 mg/ml gum arabic, 2% Triton X-100, 2 mg/ml sodium deoxycholate, ? % isopropanol Incubation: 8, Assay: 8 Incubation: Room temperature, Assay: 60Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Conflicting temperature legend main text, uncertainty about whether assay was really in aqueous phase

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*