Serine protease (gene SpSKF4) from Geobacillus thermoglucosidasius SKF4

Enzyme Description

Species

Geobacillus thermoglucosidasius SKF4 ↗

Extremophile

Yes "thermophilic" organism

EC Number

3.4.- ↗

Sequence

Length: 401 amino acids

MKFKAIVSLSLAVSMSFFPFLVEAASNDGVESPKTVSEINVSHEKGAYVQGEVIVQFKEQVNAEEKAKALKEVGATAVPDNDRVKSKFNVLKVGNVEAVVKALNNNPLVEYAEPNYLFNAAWTPNDTYYQGYQYGPQNTYTDYAWDVTKGSSGQEIAVIDTGVDYTHPDLDGKVIKGYDFVDNDYDPMDLNNHGTHVAGIAAAETNNATGIAGMAPNTRILAVRALDRNGSGTLSDIADAIIYAADSGAEVINLSLGCDCHTTTLENAVNYAWNKGSVVVAAAGNNGSSTTFEPASYENVIAVGAVDQYDRLASFSNYGTWVDVVAPGVDIVSTITGNRYAYMSGTSMASPHVAGLAALLASQGRNNIEIRQAIEQTADKISGTGTYFKYGRINSYNAVTY

Suleiman D Allison et al. (2023) — Molecular Cloning, Characterization, and Application of Organic Solvent-Stable and Detergent-Compatible Thermostable Alkaline Protease from Geobacillus thermoglucosidasius SKF4

Journal of Microbiology and Biotechnology · doi:10.4014/jmb.2306.06050 ↗ · Stability - Incubation

21 measurements ▼

Database ID

UniProt: A0A8F2ZC80 ↗

Sequence Annotation

Explicit - Provided

Protein Source

Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (21 measurements)

21 measurements — page 1 of 2

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Stability - Incubation	Activity after incubation (40 minutes at 80°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase	1-Butanol	30%	100.0	85.5	%	Incubation: ?, Assay: Glycine-NaOH buffer	Incubation: ?, Assay: 10	Incubation: 80°C, Assay: 60°C	0.7% Casein	free amino acids , Peptides	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control
Stability - Incubation	Activity after incubation (40 minutes at 80°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase	n-Hexane	50%	100.0	50.4	%	Incubation: ?, Assay: Glycine-NaOH buffer	Incubation: ?, Assay: 10	Incubation: 80°C, Assay: 60°C	0.7% Casein	free amino acids , Peptides	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control
Stability - Incubation	Activity after incubation (40 minutes at 80°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase	Chloroform	50%	100.0	68.0	%	Incubation: ?, Assay: Glycine-NaOH buffer	Incubation: ?, Assay: 10	Incubation: 80°C, Assay: 60°C	0.7% Casein	free amino acids , Peptides	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control
Stability - Incubation	Activity after incubation (40 minutes at 80°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase	Isopropanol	50%	100.0	61.2	%	Incubation: ?, Assay: Glycine-NaOH buffer	Incubation: ?, Assay: 10	Incubation: 80°C, Assay: 60°C	0.7% Casein	free amino acids , Peptides	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control
Stability - Incubation	Activity after incubation (40 minutes at 80°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase	1-Butanol	50%	100.0	66.9	%	Incubation: ?, Assay: Glycine-NaOH buffer	Incubation: ?, Assay: 10	Incubation: 80°C, Assay: 60°C	0.7% Casein	free amino acids , Peptides	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control
Stability - Incubation	Activity after incubation (40 minutes at 80°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase	Methanol	50%	100.0	81.0	%	Incubation: ?, Assay: Glycine-NaOH buffer	Incubation: ?, Assay: 10	Incubation: 80°C, Assay: 60°C	0.7% Casein	free amino acids , Peptides	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control
Stability - Incubation	Activity after incubation (40 minutes at 80°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase	Acetone	50%	100.0	71.8	%	Incubation: ?, Assay: Glycine-NaOH buffer	Incubation: ?, Assay: 10	Incubation: 80°C, Assay: 60°C	0.7% Casein	free amino acids , Peptides	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control
Stability - Incubation	Activity after incubation (40 minutes at 80°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase	Ethanol	50%	100.0	102.7	%	Incubation: ?, Assay: Glycine-NaOH buffer	Incubation: ?, Assay: 10	Incubation: 80°C, Assay: 60°C	0.7% Casein	free amino acids , Peptides	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control
Stability - Incubation	Activity after incubation (40 minutes at 80°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase	n-Hexane	30%	100.0	55.5	%	Incubation: ?, Assay: Glycine-NaOH buffer	Incubation: ?, Assay: 10	Incubation: 80°C, Assay: 60°C	0.7% Casein	free amino acids , Peptides	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control
Stability - Incubation	Activity after incubation (40 minutes at 80°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase	Chloroform	30%	100.0	89.4	%	Incubation: ?, Assay: Glycine-NaOH buffer	Incubation: ?, Assay: 10	Incubation: 80°C, Assay: 60°C	0.7% Casein	free amino acids , Peptides	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control
Stability - Incubation	Activity after incubation (40 minutes at 80°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase	Isopropanol	30%	100.0	90.6	%	Incubation: ?, Assay: Glycine-NaOH buffer	Incubation: ?, Assay: 10	Incubation: 80°C, Assay: 60°C	0.7% Casein	free amino acids , Peptides	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control
Stability - Incubation	Activity after incubation (40 minutes at 80°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase	Ethanol	10%	100.0	93.9	%	Incubation: ?, Assay: Glycine-NaOH buffer	Incubation: ?, Assay: 10	Incubation: 80°C, Assay: 60°C	0.7% Casein	free amino acids , Peptides	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control
Stability - Incubation	Activity after incubation (40 minutes at 80°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase	Methanol	30%	100.0	112.9	%	Incubation: ?, Assay: Glycine-NaOH buffer	Incubation: ?, Assay: 10	Incubation: 80°C, Assay: 60°C	0.7% Casein	free amino acids , Peptides	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control
Stability - Incubation	Activity after incubation (40 minutes at 80°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase	Acetone	30%	100.0	87.4	%	Incubation: ?, Assay: Glycine-NaOH buffer	Incubation: ?, Assay: 10	Incubation: 80°C, Assay: 60°C	0.7% Casein	free amino acids , Peptides	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control
Stability - Incubation	Activity after incubation (40 minutes at 80°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase	Ethanol	30%	100.0	104.1	%	Incubation: ?, Assay: Glycine-NaOH buffer	Incubation: ?, Assay: 10	Incubation: 80°C, Assay: 60°C	0.7% Casein	free amino acids , Peptides	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control
Stability - Incubation	Activity after incubation (40 minutes at 80°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase	n-Hexane	10%	100.0	60.6	%	Incubation: ?, Assay: Glycine-NaOH buffer	Incubation: ?, Assay: 10	Incubation: 80°C, Assay: 60°C	0.7% Casein	free amino acids , Peptides	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control
Stability - Incubation	Activity after incubation (40 minutes at 80°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase	Chloroform	10%	100.0	98.0	%	Incubation: ?, Assay: Glycine-NaOH buffer	Incubation: ?, Assay: 10	Incubation: 80°C, Assay: 60°C	0.7% Casein	free amino acids , Peptides	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control
Stability - Incubation	Activity after incubation (40 minutes at 80°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase	Isopropanol	10%	100.0	96.7	%	Incubation: ?, Assay: Glycine-NaOH buffer	Incubation: ?, Assay: 10	Incubation: 80°C, Assay: 60°C	0.7% Casein	free amino acids , Peptides	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control
Stability - Incubation	Activity after incubation (40 minutes at 80°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase	1-Butanol	10%	100.0	88.8	%	Incubation: ?, Assay: Glycine-NaOH buffer	Incubation: ?, Assay: 10	Incubation: 80°C, Assay: 60°C	0.7% Casein	free amino acids , Peptides	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control
Stability - Incubation	Activity after incubation (40 minutes at 80°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase	Methanol	10%	100.0	70.0	%	Incubation: ?, Assay: Glycine-NaOH buffer	Incubation: ?, Assay: 10	Incubation: 80°C, Assay: 60°C	0.7% Casein	free amino acids , Peptides	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control

Stability - Incubation	Activity after incubation (40 minutes at 80°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase	1-Butanol	30%	100.0	85.5	%	Incubation: ?, Assay: Glycine-NaOH buffer	Incubation: ?, Assay: 10	Incubation: 80°C, Assay: 60°C	0.7% Casein	free amino acids, Peptides	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control
Stability - Incubation	Activity after incubation (40 minutes at 80°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase	n-Hexane	50%	100.0	50.4	%	Incubation: ?, Assay: Glycine-NaOH buffer	Incubation: ?, Assay: 10	Incubation: 80°C, Assay: 60°C	0.7% Casein	free amino acids, Peptides	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control
Stability - Incubation	Activity after incubation (40 minutes at 80°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase	Chloroform	50%	100.0	68.0	%	Incubation: ?, Assay: Glycine-NaOH buffer	Incubation: ?, Assay: 10	Incubation: 80°C, Assay: 60°C	0.7% Casein	free amino acids, Peptides	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control
Stability - Incubation	Activity after incubation (40 minutes at 80°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase	Isopropanol	50%	100.0	61.2	%	Incubation: ?, Assay: Glycine-NaOH buffer	Incubation: ?, Assay: 10	Incubation: 80°C, Assay: 60°C	0.7% Casein	free amino acids, Peptides	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control
Stability - Incubation	Activity after incubation (40 minutes at 80°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase	1-Butanol	50%	100.0	66.9	%	Incubation: ?, Assay: Glycine-NaOH buffer	Incubation: ?, Assay: 10	Incubation: 80°C, Assay: 60°C	0.7% Casein	free amino acids, Peptides	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control
Stability - Incubation	Activity after incubation (40 minutes at 80°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase	Methanol	50%	100.0	81.0	%	Incubation: ?, Assay: Glycine-NaOH buffer	Incubation: ?, Assay: 10	Incubation: 80°C, Assay: 60°C	0.7% Casein	free amino acids, Peptides	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control
Stability - Incubation	Activity after incubation (40 minutes at 80°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase	Acetone	50%	100.0	71.8	%	Incubation: ?, Assay: Glycine-NaOH buffer	Incubation: ?, Assay: 10	Incubation: 80°C, Assay: 60°C	0.7% Casein	free amino acids, Peptides	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control
Stability - Incubation	Activity after incubation (40 minutes at 80°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase	Ethanol	50%	100.0	102.7	%	Incubation: ?, Assay: Glycine-NaOH buffer	Incubation: ?, Assay: 10	Incubation: 80°C, Assay: 60°C	0.7% Casein	free amino acids, Peptides	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control
Stability - Incubation	Activity after incubation (40 minutes at 80°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase	n-Hexane	30%	100.0	55.5	%	Incubation: ?, Assay: Glycine-NaOH buffer	Incubation: ?, Assay: 10	Incubation: 80°C, Assay: 60°C	0.7% Casein	free amino acids, Peptides	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control
Stability - Incubation	Activity after incubation (40 minutes at 80°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase	Chloroform	30%	100.0	89.4	%	Incubation: ?, Assay: Glycine-NaOH buffer	Incubation: ?, Assay: 10	Incubation: 80°C, Assay: 60°C	0.7% Casein	free amino acids, Peptides	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control
Stability - Incubation	Activity after incubation (40 minutes at 80°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase	Isopropanol	30%	100.0	90.6	%	Incubation: ?, Assay: Glycine-NaOH buffer	Incubation: ?, Assay: 10	Incubation: 80°C, Assay: 60°C	0.7% Casein	free amino acids, Peptides	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control
Stability - Incubation	Activity after incubation (40 minutes at 80°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase	Ethanol	10%	100.0	93.9	%	Incubation: ?, Assay: Glycine-NaOH buffer	Incubation: ?, Assay: 10	Incubation: 80°C, Assay: 60°C	0.7% Casein	free amino acids, Peptides	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control
Stability - Incubation	Activity after incubation (40 minutes at 80°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase	Methanol	30%	100.0	112.9	%	Incubation: ?, Assay: Glycine-NaOH buffer	Incubation: ?, Assay: 10	Incubation: 80°C, Assay: 60°C	0.7% Casein	free amino acids, Peptides	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control
Stability - Incubation	Activity after incubation (40 minutes at 80°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase	Acetone	30%	100.0	87.4	%	Incubation: ?, Assay: Glycine-NaOH buffer	Incubation: ?, Assay: 10	Incubation: 80°C, Assay: 60°C	0.7% Casein	free amino acids, Peptides	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control
Stability - Incubation	Activity after incubation (40 minutes at 80°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase	Ethanol	30%	100.0	104.1	%	Incubation: ?, Assay: Glycine-NaOH buffer	Incubation: ?, Assay: 10	Incubation: 80°C, Assay: 60°C	0.7% Casein	free amino acids, Peptides	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control
Stability - Incubation	Activity after incubation (40 minutes at 80°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase	n-Hexane	10%	100.0	60.6	%	Incubation: ?, Assay: Glycine-NaOH buffer	Incubation: ?, Assay: 10	Incubation: 80°C, Assay: 60°C	0.7% Casein	free amino acids, Peptides	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control
Stability - Incubation	Activity after incubation (40 minutes at 80°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase	Chloroform	10%	100.0	98.0	%	Incubation: ?, Assay: Glycine-NaOH buffer	Incubation: ?, Assay: 10	Incubation: 80°C, Assay: 60°C	0.7% Casein	free amino acids, Peptides	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control
Stability - Incubation	Activity after incubation (40 minutes at 80°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase	Isopropanol	10%	100.0	96.7	%	Incubation: ?, Assay: Glycine-NaOH buffer	Incubation: ?, Assay: 10	Incubation: 80°C, Assay: 60°C	0.7% Casein	free amino acids, Peptides	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control
Stability - Incubation	Activity after incubation (40 minutes at 80°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase	1-Butanol	10%	100.0	88.8	%	Incubation: ?, Assay: Glycine-NaOH buffer	Incubation: ?, Assay: 10	Incubation: 80°C, Assay: 60°C	0.7% Casein	free amino acids, Peptides	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control
Stability - Incubation	Activity after incubation (40 minutes at 80°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase	Methanol	10%	100.0	70.0	%	Incubation: ?, Assay: Glycine-NaOH buffer	Incubation: ?, Assay: 10	Incubation: 80°C, Assay: 60°C	0.7% Casein	free amino acids, Peptides	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control
Stability - Incubation	Activity after incubation (40 minutes at 80°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase	Acetone	10%	100.0	86.1	%	Incubation: ?, Assay: Glycine-NaOH buffer	Incubation: ?, Assay: 10	Incubation: 80°C, Assay: 60°C	0.7% Casein	free amino acids, Peptides	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control

‹ Prev

1 2

Next ›

Visualization : Stability — Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate · Scroll to zoom · Right-click drag to pan · Powered by Mol*