Peroxidase (gene CsDyP) from Comamonas serinivorans

Enzyme Description

Species
Comamonas serinivorans β†—
Extremophile
No
EC Number
1.11.1.19 β†—

Sequence

Length: 307 amino acids
MSFHTQATTHEPNHNAMFMVWVLKAGVDAKPAFRALCALVENLNNSAAARFPGTQASCVLGIGHRAWQALALPQPQPRELVEFTPIAGDRHTAVATPGDLHLHLRGADFSLCVDMAMQIRQRLQAVADCVVQVSGFRYWDGRSILGFVDGTENPQGDERDFFAQVGPEDAAYEGGSYLFVQKYIHDMTAWRALPVAEQENVIGRSKADDIEMDDDTKPSNSHSALSNVGDDRKIVRDNLPFVDDATQEIGTYFIGYASTFGTVRDMLEAMFIGKPAGNSDRILDFSRAVTGSLFFVPTLDMLGEFAE
Sivasamy Sethupathy et al. (2023) β€” Evaluation of a dye-decolorizing peroxidase from Comamonas serinivorans for lignin valorization potentials
International Journal of Biological Macromolecules  Β· doi:10.1016/j.ijbiomac.2023.127117 β†—  Β· Stability - Incubation
4 measurements ▼
Database ID
UniProt: A0A1Y0ENS5 β†—
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (4 measurements)

4 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (? At ?Β°C), measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in aqueous phase n-Hexane 5 mM 100.0 94.4 % Incubation: ?, Assay: 50 mM phosphate-citrate buffer ? ? 0.5 mM ABTS ABTS radical cation β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control
Stability - Incubation Activity after incubation (? At ?Β°C), measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in aqueous phase Methanol 5 mM 100.0 97.2 % Incubation: ?, Assay: 50 mM phosphate-citrate buffer ? ? 0.5 mM ABTS ABTS radical cation β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control
Stability - Incubation Activity after incubation (? At ?Β°C), measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in aqueous phase Ethanol 5 mM 100.0 92.9 % Incubation: ?, Assay: 50 mM phosphate-citrate buffer ? ? 0.5 mM ABTS ABTS radical cation β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control
Stability - Incubation Activity after incubation (? At ?Β°C), measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in aqueous phase Isopropanol 5 mM 100.0 76.4 % Incubation: ?, Assay: 50 mM phosphate-citrate buffer ? ? 0.5 mM ABTS ABTS radical cation β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*