Endo-1,4-β-mannanase (gene CcMan5C) Coprinopsis cinerea

Enzyme Description

Species

Coprinopsis cinerea ↗

Extremophile

No but "alkaliphilic thermophilic" enzyme

EC Number

3.2.1.78 ↗

Sequence

Length: 443 amino acids

MKLSAGLVSLAIAVTSASAQAVGPWGQCGGSGWSGATTCESGYTCQKHNEWYSQCVPGTSSAPPPPVTPQPSTTAAPPVVTPPPPTSATGFVKTNGTRFVLDGKPYTVVGSNSYWVGLSGHSRDNMNRAFADIAAAGGTTVRTWGFNEVTAYGGIPYYQIWNGRTPSVNTGANGLQNFDQVIAAAKANGIKLIVALTNNWSDYGGMDVYVRQILNSNNHDLFYTDPDVKAAFKNYIRAFVGRYVNETGILGWELANEPRCRGSTGTTSGRCTPATITAWAREMSAFIKSIDPNHLVALGDEGFYNQPGHPVYPYQGGEGIDFDVNLQIDTLDFGTVHAYPEHWGQQGNEVGFGNDWIKDHAESQKRYGKPVILEEYGVTTNKPAVYTEWLRTIQTSGLAGDLYWQAGSRLPTGSTHDDGFTVYPDQPAYQLLRSHAAAMKARG

Songling Yan et al. (2023) — Heterologous Expression, Purification and Characterization of an Alkalic Thermophilic β-Mannanase CcMan5C from Coprinopsis cinerea

Journal of Fungi · doi:10.3390/jof9030378 ↗ · Activity - Classical

8 measurements ▼

Database ID

UniProt: A8N5K9 ↗

Sequence Annotation

Explicit - Provided GenBank Accession Number

Protein Source

Recombinant, host yeast Pichia pastoris GS115

Experimental Data (8 measurements)

8 measurements

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Activity - Classical	Activity measured by absorbance spectrophotometry (DNS assay, 540 nm) in the presence of organic solvent	Methanol	10%	100.0	95.8	%	50 mM PBS buffer	8	50°C	2.5 mg/ml Locust bean gum	Reducing sugars	—	800 rpm	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (DNS assay, 540 nm) in the presence of organic solvent	Ethanol	10%	100.0	100.7	%	50 mM PBS buffer	8	50°C	2.5 mg/ml Locust bean gum	Reducing sugars	—	800 rpm	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (DNS assay, 540 nm) in the presence of organic solvent	Isopropanol	10%	100.0	126.1	%	50 mM PBS buffer	8	50°C	2.5 mg/ml Locust bean gum	Reducing sugars	—	800 rpm	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (DNS assay, 540 nm) in the presence of organic solvent	Acetone	10%	100.0	116.6	%	50 mM PBS buffer	8	50°C	2.5 mg/ml Locust bean gum	Reducing sugars	—	800 rpm	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (DNS assay, 540 nm) in the presence of organic solvent	Methanol	20%	100.0	128.6	%	50 mM PBS buffer	8	50°C	2.5 mg/ml Locust bean gum	Reducing sugars	—	800 rpm	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (DNS assay, 540 nm) in the presence of organic solvent	Ethanol	20%	100.0	109.2	%	50 mM PBS buffer	8	50°C	2.5 mg/ml Locust bean gum	Reducing sugars	—	800 rpm	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (DNS assay, 540 nm) in the presence of organic solvent	Isopropanol	20%	100.0	134.7	%	50 mM PBS buffer	8	50°C	2.5 mg/ml Locust bean gum	Reducing sugars	—	800 rpm	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (DNS assay, 540 nm) in the presence of organic solvent	Acetone	20%	100.0	111.1	%	50 mM PBS buffer	8	50°C	2.5 mg/ml Locust bean gum	Reducing sugars	—	800 rpm	Classical aqueous control (in %)

Activity - Classical	Activity measured by absorbance spectrophotometry (DNS assay, 540 nm) in the presence of organic solvent	Methanol	10%	100.0	95.8	%	50 mM PBS buffer	8	50°C	2.5 mg/ml Locust bean gum	Reducing sugars	—	800 rpm	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (DNS assay, 540 nm) in the presence of organic solvent	Ethanol	10%	100.0	100.7	%	50 mM PBS buffer	8	50°C	2.5 mg/ml Locust bean gum	Reducing sugars	—	800 rpm	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (DNS assay, 540 nm) in the presence of organic solvent	Isopropanol	10%	100.0	126.1	%	50 mM PBS buffer	8	50°C	2.5 mg/ml Locust bean gum	Reducing sugars	—	800 rpm	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (DNS assay, 540 nm) in the presence of organic solvent	Acetone	10%	100.0	116.6	%	50 mM PBS buffer	8	50°C	2.5 mg/ml Locust bean gum	Reducing sugars	—	800 rpm	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (DNS assay, 540 nm) in the presence of organic solvent	Methanol	20%	100.0	128.6	%	50 mM PBS buffer	8	50°C	2.5 mg/ml Locust bean gum	Reducing sugars	—	800 rpm	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (DNS assay, 540 nm) in the presence of organic solvent	Ethanol	20%	100.0	109.2	%	50 mM PBS buffer	8	50°C	2.5 mg/ml Locust bean gum	Reducing sugars	—	800 rpm	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (DNS assay, 540 nm) in the presence of organic solvent	Isopropanol	20%	100.0	134.7	%	50 mM PBS buffer	8	50°C	2.5 mg/ml Locust bean gum	Reducing sugars	—	800 rpm	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (DNS assay, 540 nm) in the presence of organic solvent	Acetone	20%	100.0	111.1	%	50 mM PBS buffer	8	50°C	2.5 mg/ml Locust bean gum	Reducing sugars	—	800 rpm	Classical aqueous control (in %)

Visualization : Activity — Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate · Scroll to zoom · Right-click drag to pan · Powered by Mol*