Laccase (gene PthLac) from Parageobacillus thermoglucosidasius

Enzyme Description

Species

Parageobacillus thermoglucosidasius ↗

Extremophile

Yes "thermophilic" organism

EC Number

1.10.3.2 ↗

Sequence

Length: 272 amino acids

MLDIFQQAGEEMLLLHGRCSFPNLVAGFTTKHGGVSKGAFATFNLGLHVGDEVSSVCRNRQRLADLLQFPLEQWVCCEQIHDARIEKVTSSQSGKGAADYKSAIAGTDGLYTKEAGLLLALCFADCVPLYFMAPKHGMIGLAHAGWRGTVKNIAGEMIHLWHEREHIPLDDIYVAIGPAIGACCYIVDDRVITYVDCILDGEQAPYKQVSIGQYALDLKELNKVLLIQAGVREEHIDISGYCTSCADYLFFSHRRDQGKTGRMMAFIGRKGE

Xifeng Wang et al. (2023) — Characterization of a Novel One-Domain Halotolerant Laccase from Parageobacillus thermoglucosidasius and Its Application in Dye Decolorization

Applied Biochemistry and Biotechnology · doi:10.1007/s12010-023-04389-x ↗ · Activity - Classical

9 measurements ▼

Database ID

UniParc: UPI000B56F0B7 ↗

Sequence Annotation

Explicit - Provided

Protein Source

Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (9 measurements)

9 measurements

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Activity - Classical	Activity measured by absorbance spectrophotometry (tetraguaiacol absorbance measurement, 465 nm) in the presence of organic solvent	Ethanol	5%	100.0	97.2	%	50 mM phosphate buffer	6	Room temperature	3 mM Guaiacol	Tetraguaiacol	10 mM Cu²⁺	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (tetraguaiacol absorbance measurement, 465 nm) in the presence of organic solvent	Ethanol	10%	100.0	89.4	%	50 mM phosphate buffer	6	Room temperature	3 mM Guaiacol	Tetraguaiacol	10 mM Cu²⁺	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (tetraguaiacol absorbance measurement, 465 nm) in the presence of organic solvent	Ethanol	20%	100.0	70.1	%	50 mM phosphate buffer	6	Room temperature	3 mM Guaiacol	Tetraguaiacol	10 mM Cu²⁺	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (tetraguaiacol absorbance measurement, 465 nm) in the presence of organic solvent	Acetone	5%	100.0	97.4	%	50 mM phosphate buffer	6	Room temperature	3 mM Guaiacol	Tetraguaiacol	10 mM Cu²⁺	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (tetraguaiacol absorbance measurement, 465 nm) in the presence of organic solvent	Acetone	10%	100.0	80.7	%	50 mM phosphate buffer	6	Room temperature	3 mM Guaiacol	Tetraguaiacol	10 mM Cu²⁺	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (tetraguaiacol absorbance measurement, 465 nm) in the presence of organic solvent	Acetone	20%	100.0	60.3	%	50 mM phosphate buffer	6	Room temperature	3 mM Guaiacol	Tetraguaiacol	10 mM Cu²⁺	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (tetraguaiacol absorbance measurement, 465 nm) in the presence of organic solvent	Methanol	5%	100.0	98.6	%	50 mM phosphate buffer	6	Room temperature	3 mM Guaiacol	Tetraguaiacol	10 mM Cu²⁺	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (tetraguaiacol absorbance measurement, 465 nm) in the presence of organic solvent	Methanol	10%	100.0	82.4	%	50 mM phosphate buffer	6	Room temperature	3 mM Guaiacol	Tetraguaiacol	10 mM Cu²⁺	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (tetraguaiacol absorbance measurement, 465 nm) in the presence of organic solvent	Methanol	20%	100.0	65.3	%	50 mM phosphate buffer	6	Room temperature	3 mM Guaiacol	Tetraguaiacol	10 mM Cu²⁺	—	Classical aqueous control (in %)

Activity - Classical	Activity measured by absorbance spectrophotometry (tetraguaiacol absorbance measurement, 465 nm) in the presence of organic solvent	Ethanol	5%	100.0	97.2	%	50 mM phosphate buffer	6	Room temperature	3 mM Guaiacol	Tetraguaiacol	10 mM Cu²⁺	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (tetraguaiacol absorbance measurement, 465 nm) in the presence of organic solvent	Ethanol	10%	100.0	89.4	%	50 mM phosphate buffer	6	Room temperature	3 mM Guaiacol	Tetraguaiacol	10 mM Cu²⁺	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (tetraguaiacol absorbance measurement, 465 nm) in the presence of organic solvent	Ethanol	20%	100.0	70.1	%	50 mM phosphate buffer	6	Room temperature	3 mM Guaiacol	Tetraguaiacol	10 mM Cu²⁺	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (tetraguaiacol absorbance measurement, 465 nm) in the presence of organic solvent	Acetone	5%	100.0	97.4	%	50 mM phosphate buffer	6	Room temperature	3 mM Guaiacol	Tetraguaiacol	10 mM Cu²⁺	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (tetraguaiacol absorbance measurement, 465 nm) in the presence of organic solvent	Acetone	10%	100.0	80.7	%	50 mM phosphate buffer	6	Room temperature	3 mM Guaiacol	Tetraguaiacol	10 mM Cu²⁺	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (tetraguaiacol absorbance measurement, 465 nm) in the presence of organic solvent	Acetone	20%	100.0	60.3	%	50 mM phosphate buffer	6	Room temperature	3 mM Guaiacol	Tetraguaiacol	10 mM Cu²⁺	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (tetraguaiacol absorbance measurement, 465 nm) in the presence of organic solvent	Methanol	5%	100.0	98.6	%	50 mM phosphate buffer	6	Room temperature	3 mM Guaiacol	Tetraguaiacol	10 mM Cu²⁺	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (tetraguaiacol absorbance measurement, 465 nm) in the presence of organic solvent	Methanol	10%	100.0	82.4	%	50 mM phosphate buffer	6	Room temperature	3 mM Guaiacol	Tetraguaiacol	10 mM Cu²⁺	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (tetraguaiacol absorbance measurement, 465 nm) in the presence of organic solvent	Methanol	20%	100.0	65.3	%	50 mM phosphate buffer	6	Room temperature	3 mM Guaiacol	Tetraguaiacol	10 mM Cu²⁺	—	Classical aqueous control (in %)

Visualization : Activity — Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate · Scroll to zoom · Right-click drag to pan · Powered by Mol*