Laccase (gene rLac1a) from Hericium erinaceus

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 511 amino acids
MLLSKTLSALVSVIGARMTLAAKGPVTDLHIVNTQLAPDGFLRDTVVADGVFPGPTISGNKGDNFKINVINQLTDTSMLTSTTIHWHGLFQYGTNQMDGVAFVTQCPIPPNDSFLYNFKVPDQAGTFWYHSHLSTQYCDGLRGPLIIYDPKDPHKNLYDVDDDSTVITLADWYHIPAPSAGLVPPVNSTLINGLGRSADGSASPLAVVSVTAGKRYRMRLINIACDPNYIFTIDNHAFTIIEVDGVSVQPYNVDSIQVYASQRFSFILNANQAVSNYWIRALPNTGVTTFTGGTNMAILRYAGAASVEPSTLQTPSTAPMQETALRPLVAKPAPGLAKPGGADINIELDVAFTGTQFTVNGQPWISPSVPVLLQILSGAKKASDLLPSGSIYGLAPNKSVEINIPGGAVGGGHPVHLHGHNFAVVRSAGSTVLNYQNPVWRDTVNIGTTTADNVTIRFETNNPGPWFVHCHIDWHLEAGFAVVMAEDVDDTAAVNNPTDAWDQLCPAYNNQ
Thuat Van La et al. (2023) β€” Biocatalytic characterization of Hericium erinaceus laccase isoenzymes for the oxidation of lignin derivative substrates
International Journal of Biological Macromolecules  Β· doi:10.1016/j.ijbiomac.2023.124658 β†—  Β· Activity - Classical
18 measurements
Database ID
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host yeast Pichia pastoris GS115

Experimental Data (18 measurements)

18 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) in the presence of organic solvent 1-Butanol 10% 100.0 42.5 % 100 mM citrate-phosphate buffer 5 30Β°C 1 mM ABTS, Hβ‚‚Oβ‚‚ (Hydrogen Peroxide) ABTS radical cation β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) in the presence of organic solvent Acetone 10% 100.0 65.2 % 100 mM citrate-phosphate buffer 5 30Β°C 1 mM ABTS, Hβ‚‚Oβ‚‚ (Hydrogen Peroxide) ABTS radical cation β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) in the presence of organic solvent Acetone 5% 100.0 87.7 % 100 mM citrate-phosphate buffer 5 30Β°C 1 mM ABTS, Hβ‚‚Oβ‚‚ (Hydrogen Peroxide) ABTS radical cation β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 10% 100.0 62.1 % 100 mM citrate-phosphate buffer 5 30Β°C 1 mM ABTS, Hβ‚‚Oβ‚‚ (Hydrogen Peroxide) ABTS radical cation β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 5% 100.0 79.1 % 100 mM citrate-phosphate buffer 5 30Β°C 1 mM ABTS, Hβ‚‚Oβ‚‚ (Hydrogen Peroxide) ABTS radical cation β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) in the presence of organic solvent Acetonitrile 10% 100.0 63.1 % 100 mM citrate-phosphate buffer 5 30Β°C 1 mM ABTS, Hβ‚‚Oβ‚‚ (Hydrogen Peroxide) ABTS radical cation β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) in the presence of organic solvent Acetonitrile 5% 100.0 74.5 % 100 mM citrate-phosphate buffer 5 30Β°C 1 mM ABTS, Hβ‚‚Oβ‚‚ (Hydrogen Peroxide) ABTS radical cation β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) in the presence of organic solvent 2-Butanol 10% 100.0 41.7 % 100 mM citrate-phosphate buffer 5 30Β°C 1 mM ABTS, Hβ‚‚Oβ‚‚ (Hydrogen Peroxide) ABTS radical cation β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) in the presence of organic solvent 2-Butanol 5% 100.0 68.7 % 100 mM citrate-phosphate buffer 5 30Β°C 1 mM ABTS, Hβ‚‚Oβ‚‚ (Hydrogen Peroxide) ABTS radical cation β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) in the presence of organic solvent Methanol 5% 100.0 89.1 % 100 mM citrate-phosphate buffer 5 30Β°C 1 mM ABTS, Hβ‚‚Oβ‚‚ (Hydrogen Peroxide) ABTS radical cation β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) in the presence of organic solvent 1-Butanol 5% 100.0 70.6 % 100 mM citrate-phosphate buffer 5 30Β°C 1 mM ABTS, Hβ‚‚Oβ‚‚ (Hydrogen Peroxide) ABTS radical cation β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) in the presence of organic solvent Isopropanol 10% 100.0 56.5 % 100 mM citrate-phosphate buffer 5 30Β°C 1 mM ABTS, Hβ‚‚Oβ‚‚ (Hydrogen Peroxide) ABTS radical cation β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) in the presence of organic solvent Isopropanol 5% 100.0 71.6 % 100 mM citrate-phosphate buffer 5 30Β°C 1 mM ABTS, Hβ‚‚Oβ‚‚ (Hydrogen Peroxide) ABTS radical cation β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) in the presence of organic solvent 1-Propanol 10% 100.0 58.2 % 100 mM citrate-phosphate buffer 5 30Β°C 1 mM ABTS, Hβ‚‚Oβ‚‚ (Hydrogen Peroxide) ABTS radical cation β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) in the presence of organic solvent 1-Propanol 5% 100.0 73.2 % 100 mM citrate-phosphate buffer 5 30Β°C 1 mM ABTS, Hβ‚‚Oβ‚‚ (Hydrogen Peroxide) ABTS radical cation β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) in the presence of organic solvent Ethanol 10% 100.0 67.2 % 100 mM citrate-phosphate buffer 5 30Β°C 1 mM ABTS, Hβ‚‚Oβ‚‚ (Hydrogen Peroxide) ABTS radical cation β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) in the presence of organic solvent Ethanol 5% 100.0 78.6 % 100 mM citrate-phosphate buffer 5 30Β°C 1 mM ABTS, Hβ‚‚Oβ‚‚ (Hydrogen Peroxide) ABTS radical cation β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) in the presence of organic solvent Methanol 10% 100.0 71.4 % 100 mM citrate-phosphate buffer 5 30Β°C 1 mM ABTS, Hβ‚‚Oβ‚‚ (Hydrogen Peroxide) ABTS radical cation β€” β€” Classical aqueous control (in %)

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*