Laccase (gene rLac1a) from Hericium erinaceus
Enzyme Description
Sequence
MLLSKTLSALVSVIGARMTLAAKGPVTDLHIVNTQLAPDGFLRDTVVADGVFPGPTISGNKGDNFKINVINQLTDTSMLTSTTIHWHGLFQYGTNQMDGVAFVTQCPIPPNDSFLYNFKVPDQAGTFWYHSHLSTQYCDGLRGPLIIYDPKDPHKNLYDVDDDSTVITLADWYHIPAPSAGLVPPVNSTLINGLGRSADGSASPLAVVSVTAGKRYRMRLINIACDPNYIFTIDNHAFTIIEVDGVSVQPYNVDSIQVYASQRFSFILNANQAVSNYWIRALPNTGVTTFTGGTNMAILRYAGAASVEPSTLQTPSTAPMQETALRPLVAKPAPGLAKPGGADINIELDVAFTGTQFTVNGQPWISPSVPVLLQILSGAKKASDLLPSGSIYGLAPNKSVEINIPGGAVGGGHPVHLHGHNFAVVRSAGSTVLNYQNPVWRDTVNIGTTTADNVTIRFETNNPGPWFVHCHIDWHLEAGFAVVMAEDVDDTAAVNNPTDAWDQLCPAYNNQ
Thuat Van La et al. (2023)
β Biocatalytic characterization of Hericium erinaceus laccase isoenzymes for the oxidation of lignin derivative substrates
International Journal of Biological Macromolecules
Β· doi:10.1016/j.ijbiomac.2023.124658 β
Β· Activity - Classical
▼
Database ID
UniParc: UPI0035D27575 β
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host yeast Pichia pastoris GS115
Experimental Data (18 measurements)
18 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) in the presence of organic solvent | 1-Butanol | 10% | 100.0 | 42.5 | % | 100 mM citrate-phosphate buffer | 5 | 30Β°C | 1 mM ABTS, HβOβ (Hydrogen Peroxide) | ABTS radical cation | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) in the presence of organic solvent | Acetone | 10% | 100.0 | 65.2 | % | 100 mM citrate-phosphate buffer | 5 | 30Β°C | 1 mM ABTS, HβOβ (Hydrogen Peroxide) | ABTS radical cation | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) in the presence of organic solvent | Acetone | 5% | 100.0 | 87.7 | % | 100 mM citrate-phosphate buffer | 5 | 30Β°C | 1 mM ABTS, HβOβ (Hydrogen Peroxide) | ABTS radical cation | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 10% | 100.0 | 62.1 | % | 100 mM citrate-phosphate buffer | 5 | 30Β°C | 1 mM ABTS, HβOβ (Hydrogen Peroxide) | ABTS radical cation | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 5% | 100.0 | 79.1 | % | 100 mM citrate-phosphate buffer | 5 | 30Β°C | 1 mM ABTS, HβOβ (Hydrogen Peroxide) | ABTS radical cation | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) in the presence of organic solvent | Acetonitrile | 10% | 100.0 | 63.1 | % | 100 mM citrate-phosphate buffer | 5 | 30Β°C | 1 mM ABTS, HβOβ (Hydrogen Peroxide) | ABTS radical cation | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) in the presence of organic solvent | Acetonitrile | 5% | 100.0 | 74.5 | % | 100 mM citrate-phosphate buffer | 5 | 30Β°C | 1 mM ABTS, HβOβ (Hydrogen Peroxide) | ABTS radical cation | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) in the presence of organic solvent | 2-Butanol | 10% | 100.0 | 41.7 | % | 100 mM citrate-phosphate buffer | 5 | 30Β°C | 1 mM ABTS, HβOβ (Hydrogen Peroxide) | ABTS radical cation | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) in the presence of organic solvent | 2-Butanol | 5% | 100.0 | 68.7 | % | 100 mM citrate-phosphate buffer | 5 | 30Β°C | 1 mM ABTS, HβOβ (Hydrogen Peroxide) | ABTS radical cation | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) in the presence of organic solvent | Methanol | 5% | 100.0 | 89.1 | % | 100 mM citrate-phosphate buffer | 5 | 30Β°C | 1 mM ABTS, HβOβ (Hydrogen Peroxide) | ABTS radical cation | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) in the presence of organic solvent | 1-Butanol | 5% | 100.0 | 70.6 | % | 100 mM citrate-phosphate buffer | 5 | 30Β°C | 1 mM ABTS, HβOβ (Hydrogen Peroxide) | ABTS radical cation | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) in the presence of organic solvent | Isopropanol | 10% | 100.0 | 56.5 | % | 100 mM citrate-phosphate buffer | 5 | 30Β°C | 1 mM ABTS, HβOβ (Hydrogen Peroxide) | ABTS radical cation | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) in the presence of organic solvent | Isopropanol | 5% | 100.0 | 71.6 | % | 100 mM citrate-phosphate buffer | 5 | 30Β°C | 1 mM ABTS, HβOβ (Hydrogen Peroxide) | ABTS radical cation | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) in the presence of organic solvent | 1-Propanol | 10% | 100.0 | 58.2 | % | 100 mM citrate-phosphate buffer | 5 | 30Β°C | 1 mM ABTS, HβOβ (Hydrogen Peroxide) | ABTS radical cation | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) in the presence of organic solvent | 1-Propanol | 5% | 100.0 | 73.2 | % | 100 mM citrate-phosphate buffer | 5 | 30Β°C | 1 mM ABTS, HβOβ (Hydrogen Peroxide) | ABTS radical cation | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) in the presence of organic solvent | Ethanol | 10% | 100.0 | 67.2 | % | 100 mM citrate-phosphate buffer | 5 | 30Β°C | 1 mM ABTS, HβOβ (Hydrogen Peroxide) | ABTS radical cation | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) in the presence of organic solvent | Ethanol | 5% | 100.0 | 78.6 | % | 100 mM citrate-phosphate buffer | 5 | 30Β°C | 1 mM ABTS, HβOβ (Hydrogen Peroxide) | ABTS radical cation | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) in the presence of organic solvent | Methanol | 10% | 100.0 | 71.4 | % | 100 mM citrate-phosphate buffer | 5 | 30Β°C | 1 mM ABTS, HβOβ (Hydrogen Peroxide) | ABTS radical cation | β | β | Classical aqueous control (in %) |
Visualization : Activity β Classical
One bar per measurement. Colour = solvent, shade = solvent volume.