Esterase (gene est6) from an activated sludge metagenomic library

Enzyme Description

Species
Na (activated sludge metagenomic library)
Extremophile
No
EC Number
3.1.1.1 β†—

Sequence

Length: 242 amino acids
MTELRINDDLVRWTVDRRPATADEALRALETRPLVLLMHGFGSFEGDLISLAAELPDGIVCASPRAPLTLPPPTVNGYAWWEIVFRADGTVVRSDPPAFEDSDAHTATLAILAWLDALDARVAGGLRTVVPLGFSQGGCMVTSLLRMQPTRFPCGVNCSGFVAPGSYAGDPELAAIRPPLFWGRDPADPIIEAERIDATAVWSAAHTAIEAHIYHGIGHGIGREEIADISAFIERHLAEAEH
Ren-Bao Liaw et al. (2022) β€” Molecular Cloning and Characterization of a New Family VI Esterase from an Activated Sludge Metagenome
Microorganisms  Β· doi:10.3390/microorganisms10122403 β†—  Β· Stability - Incubation
8 measurements ▼
Database ID
UniProt: E0WCJ6 β†—
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (8 measurements)

8 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (30 minutes at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Methanol 10% 100.0 97.0 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 30Β°C 1 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase, uncertainty about control
Stability - Incubation Activity after incubation (30 minutes at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Ethanol 10% 100.0 85.5 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 30Β°C 1 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase, uncertainty about control
Stability - Incubation Activity after incubation (30 minutes at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Isopropanol 10% 100.0 83.8 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 30Β°C 1 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase, uncertainty about control
Stability - Incubation Activity after incubation (30 minutes at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase 1-Butanol 10% 100.0 0.3 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 30Β°C 1 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase, uncertainty about control
Stability - Incubation Activity after incubation (30 minutes at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Acetone 10% 100.0 43.0 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 30Β°C 1 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase, uncertainty about control
Stability - Incubation Activity after incubation (30 minutes at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Acetonitrile 10% 100.0 29.1 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 30Β°C 1 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase, uncertainty about control
Stability - Incubation Activity after incubation (30 minutes at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Dimethylformamide (DMF) 10% 100.0 38.9 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 30Β°C 1 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase, uncertainty about control
Stability - Incubation Activity after incubation (30 minutes at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 10% 100.0 69.9 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 30Β°C 1 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase, uncertainty about control

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*