Halolysin (gene Hly_Hap) from Haladaptatus sp. DYF46

Enzyme Description

Species
Haladaptatus sp. DYF46 β†—
Extremophile
Yes "extremely halophilic" organism
EC Number
3.4.- β†—

Sequence

Length: 395 amino acids
MARKANGVSRRNILKLTGGSLATASATGLASAAPTDKVEVNVGFNSARGRAMTRSSADDVVREFNSIDAMTIRVPKRAATALEKNPNIRYVEENGTMEALAQTTPWGVDRVDADVAHDNGDTGAGADIAIIDTGIDDDHPDLQSNVGAGKSFVSCGSGGFTGNCLFYGNDSCNDSWSDDNHNGTHCAGIANGVDNDQGVVGVSTQATLHAVKVLDCAGSGTFSDIAAGVEYVADQGWDVASMSLGGSSGSQALHDAIQYAYDAGVVLVAAAGNDGQCTDCVGYPAAYEETVTVASSNSDDEQSSFSSQGPEVNIIAPGTDIYSTVPGGYDTYSGTSMATPHVAGAAGQLIAQGYSARDAESRLLDTAEDLGLPSNEQGSGLLDVAAALGLDSSDN
Jing Hou et al. (2022) β€” A novel halolysin without C-terminal extension from an extremely halophilic archaeon
Applied Microbiology and Biotechnology  Β· doi:10.1007/s00253-022-11903-4 β†—  Β· Activity - Classical
8 measurements ▼
Database ID
NCBI: WP_231183239.1 β†—
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli Transetta (DE3)

Experimental Data (8 measurements)

8 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, Azo-peptides absorbance measurement, 440 nm) in the presence of organic solvent Glycerol 15% 100.0 99.6 % 100 mM Tris-HCl buffer, 0.5 M NaCl 8.5 45Β°C 0.25% Azocasein Azo-peptides , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, Azo-peptides absorbance measurement, 440 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 15% 100.0 96.9 % 100 mM Tris-HCl buffer, 0.5 M NaCl 8.5 45Β°C 0.25% Azocasein Azo-peptides , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, Azo-peptides absorbance measurement, 440 nm) in the presence of organic solvent Dimethylformamide (DMF) 15% 100.0 96.7 % 100 mM Tris-HCl buffer, 0.5 M NaCl 8.5 45Β°C 0.25% Azocasein Azo-peptides , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, Azo-peptides absorbance measurement, 440 nm) in the presence of organic solvent Methanol 15% 100.0 96.1 % 100 mM Tris-HCl buffer, 0.5 M NaCl 8.5 45Β°C 0.25% Azocasein Azo-peptides , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, Azo-peptides absorbance measurement, 440 nm) in the presence of organic solvent Acetonitrile 15% 100.0 98.2 % 100 mM Tris-HCl buffer, 0.5 M NaCl 8.5 45Β°C 0.25% Azocasein Azo-peptides , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, Azo-peptides absorbance measurement, 440 nm) in the presence of organic solvent Ethanol 15% 100.0 62.0 % 100 mM Tris-HCl buffer, 0.5 M NaCl 8.5 45Β°C 0.25% Azocasein Azo-peptides , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, Azo-peptides absorbance measurement, 440 nm) in the presence of organic solvent Acetone 15% 100.0 84.6 % 100 mM Tris-HCl buffer, 0.5 M NaCl 8.5 45Β°C 0.25% Azocasein Azo-peptides , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, Azo-peptides absorbance measurement, 440 nm) in the presence of organic solvent Isopropanol 15% 100.0 38.4 % 100 mM Tris-HCl buffer, 0.5 M NaCl 8.5 45Β°C 0.25% Azocasein Azo-peptides , Peptides β€” β€” Classical aqueous control (in %)

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*