Esterase from Bacillus subtilis E9

Enzyme Description

Species
Bacillus subtilis E9 β†—
Extremophile
No
EC Number
3.1.1.1 β†—

Sequence

Length: 166 amino acids
ASYNFFAIKNYLVSQGWQSNKLYAIDFYDKTGNNLNNGPQLASYVDRVLKETGAKKVDIVAHSMGGANTLYYIKYLGGGNKIQNVVTLGGANGLVSSKALPGTDPNQKILYTSIYSLNDEIVINSLSRLQGARNIQLYGIGHIGLLSNSLVNGYIKEGLNGGGLNT
P. Soumya et al. (2022) β€” An Esterase with Increased Acetone Tolerance from Bacillus subtilis E9 over Expressed in E. coli BL21 Using pTac Bs-est Vector
Molecular Biotechnology  Β· doi:10.1007/s12033-022-00458-4 β†—  Β· Activity - Classical
9 measurements ▼
Database ID
β€”
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (9 measurements)

9 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent n-Hexane 30% 100 84 % 100 mM Tris-HCl buffer 8 Room temperature 1 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %) | Uncertainty about temperature
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 30% 100 93 % 100 mM Tris-HCl buffer 8 Room temperature 1 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %) | Uncertainty about temperature
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent Acetone 30% 100 96 % 100 mM Tris-HCl buffer 8 Room temperature 1 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %) | Uncertainty about temperature
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent Ethanol 30% 100 80 % 100 mM Tris-HCl buffer 8 Room temperature 1 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %) | Uncertainty about temperature
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent Methanol 30% 100 67 % 100 mM Tris-HCl buffer 8 Room temperature 1 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %) | Uncertainty about temperature
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent Acetone 30% 100 95 % 100 mM Tris-HCl buffer 8 Room temperature 1 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %) | Uncertainty about temperature
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent Acetone 50% 100 94 % 100 mM Tris-HCl buffer 8 Room temperature 1 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %) | Uncertainty about temperature
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent Acetone 70% 100 96 % 100 mM Tris-HCl buffer 8 Room temperature 1 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %) | Uncertainty about temperature
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent Acetone 90% 100 96 % 100 mM Tris-HCl buffer 8 Room temperature 1 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %) | Uncertainty about temperature

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*