Laccase (gene Ghlac) from Geothermobacter hydrogeniphilus

Enzyme Description

Extremophile
Yes "thermophilic" organism
EC Number

Sequence

Length: 262 amino acids
MKMARNGKIYYLEPEWIHGSVRAGFTTRNGGISRPPYNSLNLGLNTGDPRPNVEGNRERLVRAFGLEPHQLLTVRQVHGNILVVDEPNPDLSHFQQVECDAIISNQPGMMIGVLVADCYPVLLAAPANGVVAAVHVGWRGAVAQIIQRTVDALQEQFGVRPEDLLAAVGPGIGACCYEVDRPVRDQFRKAGEPWDEVAEESRDGHWKLDLREACRRQLLDAGVKAEHIDLAEWCTCCHRELFFSHRRDNGRTGRMLGFILLT
Guotao Mao et al. (2021) β€” An Engineered Thermostable Laccase with Great Ability to Decolorize and Detoxify Malachite Green
International Journal of Molecular Sciences  Β· doi:10.3390/ijms222111755 β†—  Β· Stability - Incubation
12 measurements
Database ID
β€”
Sequence Annotation
Explicit - Provided (Mut2 sequence in publication)
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (12 measurements)

12 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (30 minutes at 4Β°C), measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in aqueous phase Formaldehyde 10% 100.0 87.7 % Incubation: ?, Assay: 20 mM acetic acid-sodium acetate buffer Incubation: ?, Assay: 4 Incubation: 4Β°C, Assay: 50Β°C 1 mM ABTS ABTS radical cation Assay: 1 mM CuSOβ‚„ β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase
Stability - Incubation Activity after incubation (30 minutes at 4Β°C), measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in aqueous phase Formaldehyde 20% 100.0 63.1 % Incubation: ?, Assay: 20 mM acetic acid-sodium acetate buffer Incubation: ?, Assay: 4 Incubation: 4Β°C, Assay: 50Β°C 1 mM ABTS ABTS radical cation Assay: 1 mM CuSOβ‚„ β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase
Stability - Incubation Activity after incubation (30 minutes at 4Β°C), measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in aqueous phase Methanol 10% 100.0 91.3 % Incubation: ?, Assay: 20 mM acetic acid-sodium acetate buffer Incubation: ?, Assay: 4 Incubation: 4Β°C, Assay: 50Β°C 1 mM ABTS ABTS radical cation Assay: 1 mM CuSOβ‚„ β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase
Stability - Incubation Activity after incubation (30 minutes at 4Β°C), measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in aqueous phase Methanol 20% 100.0 80.6 % Incubation: ?, Assay: 20 mM acetic acid-sodium acetate buffer Incubation: ?, Assay: 4 Incubation: 4Β°C, Assay: 50Β°C 1 mM ABTS ABTS radical cation Assay: 1 mM CuSOβ‚„ β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase
Stability - Incubation Activity after incubation (30 minutes at 4Β°C), measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in aqueous phase Ethanol 10% 100.0 104.5 % Incubation: ?, Assay: 20 mM acetic acid-sodium acetate buffer Incubation: ?, Assay: 4 Incubation: 4Β°C, Assay: 50Β°C 1 mM ABTS ABTS radical cation Assay: 1 mM CuSOβ‚„ β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase
Stability - Incubation Activity after incubation (30 minutes at 4Β°C), measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in aqueous phase Ethanol 20% 100.0 92.6 % Incubation: ?, Assay: 20 mM acetic acid-sodium acetate buffer Incubation: ?, Assay: 4 Incubation: 4Β°C, Assay: 50Β°C 1 mM ABTS ABTS radical cation Assay: 1 mM CuSOβ‚„ β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase
Stability - Incubation Activity after incubation (30 minutes at 4Β°C), measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in aqueous phase Acetone 10% 100.0 101.3 % Incubation: ?, Assay: 20 mM acetic acid-sodium acetate buffer Incubation: ?, Assay: 4 Incubation: 4Β°C, Assay: 50Β°C 1 mM ABTS ABTS radical cation Assay: 1 mM CuSOβ‚„ β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase
Stability - Incubation Activity after incubation (30 minutes at 4Β°C), measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in aqueous phase Acetone 20% 100.0 101.9 % Incubation: ?, Assay: 20 mM acetic acid-sodium acetate buffer Incubation: ?, Assay: 4 Incubation: 4Β°C, Assay: 50Β°C 1 mM ABTS ABTS radical cation Assay: 1 mM CuSOβ‚„ β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase
Stability - Incubation Activity after incubation (30 minutes at 4Β°C), measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in aqueous phase Isopropanol 10% 100.0 99.0 % Incubation: ?, Assay: 20 mM acetic acid-sodium acetate buffer Incubation: ?, Assay: 4 Incubation: 4Β°C, Assay: 50Β°C 1 mM ABTS ABTS radical cation Assay: 1 mM CuSOβ‚„ β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase
Stability - Incubation Activity after incubation (30 minutes at 4Β°C), measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in aqueous phase Isopropanol 20% 100.0 81.6 % Incubation: ?, Assay: 20 mM acetic acid-sodium acetate buffer Incubation: ?, Assay: 4 Incubation: 4Β°C, Assay: 50Β°C 1 mM ABTS ABTS radical cation Assay: 1 mM CuSOβ‚„ β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase
Stability - Incubation Activity after incubation (30 minutes at 4Β°C), measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 10% 100.0 119.4 % Incubation: ?, Assay: 20 mM acetic acid-sodium acetate buffer Incubation: ?, Assay: 4 Incubation: 4Β°C, Assay: 50Β°C 1 mM ABTS ABTS radical cation Assay: 1 mM CuSOβ‚„ β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase
Stability - Incubation Activity after incubation (30 minutes at 4Β°C), measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 20% 100.0 90.3 % Incubation: ?, Assay: 20 mM acetic acid-sodium acetate buffer Incubation: ?, Assay: 4 Incubation: 4Β°C, Assay: 50Β°C 1 mM ABTS ABTS radical cation Assay: 1 mM CuSOβ‚„ β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*