Laccase (gene Ghlac) from Geothermobacter hydrogeniphilus
Enzyme Description
Extremophile
Yes
"thermophilic" organism
EC Number
Sequence
MKMARNGKIYYLEPEWIHGSVRAGFTTRNGGISRPPYNSLNLGLNTGDPRPNVEGNRERLVRAFGLEPHQLLTVRQVHGNILVVDEPNPDLSHFQQVECDAIISNQPGMMIGVLVADCYPVLLAAPANGVVAAVHVGWRGAVAQIIQRTVDALQEQFGVRPEDLLAAVGPGIGACCYEVDRPVRDQFRKAGEPWDEVAEESRDGHWKLDLREACRRQLLDAGVKAEHIDLAEWCTCCHRELFFSHRRDNGRTGRMLGFILLT
Guotao Mao et al. (2021)
β An Engineered Thermostable Laccase with Great Ability to Decolorize and Detoxify Malachite Green
International Journal of Molecular Sciences
Β· doi:10.3390/ijms222111755 β
Β· Stability - Incubation
▼
Database ID
β
Sequence Annotation
Explicit - Provided (Mut2 sequence in publication)
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (12 measurements)
12 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (30 minutes at 4Β°C), measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in aqueous phase | Formaldehyde | 10% | 100.0 | 87.7 | % | Incubation: ?, Assay: 20 mM acetic acid-sodium acetate buffer | Incubation: ?, Assay: 4 | Incubation: 4Β°C, Assay: 50Β°C | 1 mM ABTS | ABTS radical cation | Assay: 1 mM CuSOβ | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 4Β°C), measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in aqueous phase | Formaldehyde | 20% | 100.0 | 63.1 | % | Incubation: ?, Assay: 20 mM acetic acid-sodium acetate buffer | Incubation: ?, Assay: 4 | Incubation: 4Β°C, Assay: 50Β°C | 1 mM ABTS | ABTS radical cation | Assay: 1 mM CuSOβ | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 4Β°C), measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in aqueous phase | Methanol | 10% | 100.0 | 91.3 | % | Incubation: ?, Assay: 20 mM acetic acid-sodium acetate buffer | Incubation: ?, Assay: 4 | Incubation: 4Β°C, Assay: 50Β°C | 1 mM ABTS | ABTS radical cation | Assay: 1 mM CuSOβ | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 4Β°C), measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in aqueous phase | Methanol | 20% | 100.0 | 80.6 | % | Incubation: ?, Assay: 20 mM acetic acid-sodium acetate buffer | Incubation: ?, Assay: 4 | Incubation: 4Β°C, Assay: 50Β°C | 1 mM ABTS | ABTS radical cation | Assay: 1 mM CuSOβ | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 4Β°C), measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in aqueous phase | Ethanol | 10% | 100.0 | 104.5 | % | Incubation: ?, Assay: 20 mM acetic acid-sodium acetate buffer | Incubation: ?, Assay: 4 | Incubation: 4Β°C, Assay: 50Β°C | 1 mM ABTS | ABTS radical cation | Assay: 1 mM CuSOβ | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 4Β°C), measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in aqueous phase | Ethanol | 20% | 100.0 | 92.6 | % | Incubation: ?, Assay: 20 mM acetic acid-sodium acetate buffer | Incubation: ?, Assay: 4 | Incubation: 4Β°C, Assay: 50Β°C | 1 mM ABTS | ABTS radical cation | Assay: 1 mM CuSOβ | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 4Β°C), measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in aqueous phase | Acetone | 10% | 100.0 | 101.3 | % | Incubation: ?, Assay: 20 mM acetic acid-sodium acetate buffer | Incubation: ?, Assay: 4 | Incubation: 4Β°C, Assay: 50Β°C | 1 mM ABTS | ABTS radical cation | Assay: 1 mM CuSOβ | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 4Β°C), measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in aqueous phase | Acetone | 20% | 100.0 | 101.9 | % | Incubation: ?, Assay: 20 mM acetic acid-sodium acetate buffer | Incubation: ?, Assay: 4 | Incubation: 4Β°C, Assay: 50Β°C | 1 mM ABTS | ABTS radical cation | Assay: 1 mM CuSOβ | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 4Β°C), measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in aqueous phase | Isopropanol | 10% | 100.0 | 99.0 | % | Incubation: ?, Assay: 20 mM acetic acid-sodium acetate buffer | Incubation: ?, Assay: 4 | Incubation: 4Β°C, Assay: 50Β°C | 1 mM ABTS | ABTS radical cation | Assay: 1 mM CuSOβ | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 4Β°C), measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in aqueous phase | Isopropanol | 20% | 100.0 | 81.6 | % | Incubation: ?, Assay: 20 mM acetic acid-sodium acetate buffer | Incubation: ?, Assay: 4 | Incubation: 4Β°C, Assay: 50Β°C | 1 mM ABTS | ABTS radical cation | Assay: 1 mM CuSOβ | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 4Β°C), measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 10% | 100.0 | 119.4 | % | Incubation: ?, Assay: 20 mM acetic acid-sodium acetate buffer | Incubation: ?, Assay: 4 | Incubation: 4Β°C, Assay: 50Β°C | 1 mM ABTS | ABTS radical cation | Assay: 1 mM CuSOβ | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 4Β°C), measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 20% | 100.0 | 90.3 | % | Incubation: ?, Assay: 20 mM acetic acid-sodium acetate buffer | Incubation: ?, Assay: 4 | Incubation: 4Β°C, Assay: 50Β°C | 1 mM ABTS | ABTS radical cation | Assay: 1 mM CuSOβ | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.