Cyclomaltodextrin glucanotransferase (gene cgt) from Bacillus circulans

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 713 amino acids
MKKFLKSTAALALGLSLTFGLFSPAQAAPDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDAVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Anne D. Blackwood et al. (2000) β€” Addition of polar organic solvents can improve the product selectivity of cyclodextrin glycosyltransferase
Enzyme and Microbial Technology  Β· doi:10.1016/s0141-0229(00)00270-2 β†—  Β· Activity + Stability - Product Formation
5 measurements
Database ID
UniProt: P43379 β†—
Sequence Annotation
Inferred
Protein Source
Unclear (gift)

Experimental Data (5 measurements)

5 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity + Stability - Product Formation Cyclodextrin formation yield after incubation (4 hours at 50Β°C) in the presence of organic solvent, measured by HPLC Dimethyl Sulfoxide (DMSO) 10% 40 45 % 10 mM Na-citrate buffer 6 50Β°C partially hydrolyzed Ssluble potato starch with an average degree of polymerization of 50), Soluble starch (Paselli SA2 Cyclodextrins β€” β€” Classical aqueous control (in %)
Activity + Stability - Product Formation Cyclodextrin formation yield after incubation (4 hours at 50Β°C) in the presence of organic solvent, measured by HPLC Dimethylformamide (DMF) 10% 40 51 % 10 mM Na-citrate buffer 6 50Β°C partially hydrolyzed Ssluble potato starch with an average degree of polymerization of 50), Soluble starch (Paselli SA2 Cyclodextrins β€” β€” Classical aqueous control (in %)
Activity + Stability - Product Formation Cyclodextrin formation yield after incubation (4 hours at 50Β°C) in the presence of organic solvent, measured by HPLC Acetonitrile 10% 40 45 % 10 mM Na-citrate buffer 6 50Β°C partially hydrolyzed Ssluble potato starch with an average degree of polymerization of 50), Soluble starch (Paselli SA2 Cyclodextrins β€” β€” Classical aqueous control (in %)
Activity + Stability - Product Formation Cyclodextrin formation yield after incubation (4 hours at 50Β°C) in the presence of organic solvent, measured by HPLC Tetrahydrofuran (THF) 10% 40 42 % 10 mM Na-citrate buffer 6 50Β°C partially hydrolyzed Ssluble potato starch with an average degree of polymerization of 50), Soluble starch (Paselli SA2 Cyclodextrins β€” β€” Classical aqueous control (in %)
Activity + Stability - Product Formation Cyclodextrin formation yield after incubation (4 hours at 50Β°C) in the presence of organic solvent, measured by HPLC tert-Butanol 10% 40 44 % 10 mM Na-citrate buffer 6 50Β°C partially hydrolyzed Ssluble potato starch with an average degree of polymerization of 50), Soluble starch (Paselli SA2 Cyclodextrins β€” β€” Classical aqueous control (in %)

Visualization : Activity + Stability β€” Product Formation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*