Nitrilase A (gene NitA) from Variovorax boronicumulans CGMCC 4969

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 334 amino acids
MPTTVHPQLRVAAVQAAPVFLDLDATIDKTIDLMAQAAKQSVQLIAFPETWVPGYPWWVWLDSPAWGMQFVQRYHDNSLIIGSPEFERLQAAARQHRIWLSLGYSEKAAGSLYIAQALIDDQGRTVQTRRKLKPTHVERTVFGEGDGADLHVVQTPLGNIGSLCCWEHLQPLSKYAMYAQNEQIHCGAWPSFSLYRGAAYALGHEVNNAASQVYAVEGGCFVIAPCATVSKAMSELMCTDDGKRQMLGVGGGHARIYGPDGSPLGTPLAEDAEGLVIADIDLGMIALAKAAADPSGHYSRPDVTQLLLNKTRRTPVVVQLTPEPEGSVPEPVVA
Huoyong Jiang et al. (2022) β€” Characterization of nitrilases from Variovorax boronicumulans that functions in insecticide flonicamid degradation and Ξ²-cyano-L-alanine detoxification
Journal of Applied Microbiology  Β· doi:10.1111/jam.15561 β†—  Β· Activity - Classical
8 measurements
Database ID
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli Rosetta

Experimental Data (8 measurements)

8 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by HPLC (N-(4-trifluoromethylnicotinoyl)glycinamide (TFNG-AM), 4-(trifluoromethyl)nicotinoyl glycine (TFNG) product formation measurement) in the presence of organic solvent Acetone 2% 100 25 % 50 mM PBS buffer 7 37Β°C 0.84 mM Flonicamid 4-(trifluoromethyl)nicotinoyl glycine (TFNG) , N-(4-trifluoromethylnicotinoyl)glycinamide (TFNG-AM) β€” 800 rpm Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (N-(4-trifluoromethylnicotinoyl)glycinamide (TFNG-AM), 4-(trifluoromethyl)nicotinoyl glycine (TFNG) product formation measurement) in the presence of organic solvent Cyclohexane 2% 100 2 % 50 mM PBS buffer 7 37Β°C 0.84 mM Flonicamid 4-(trifluoromethyl)nicotinoyl glycine (TFNG) , N-(4-trifluoromethylnicotinoyl)glycinamide (TFNG-AM) β€” 800 rpm Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (N-(4-trifluoromethylnicotinoyl)glycinamide (TFNG-AM), 4-(trifluoromethyl)nicotinoyl glycine (TFNG) product formation measurement) in the presence of organic solvent Methanol 2% 100 76 % 50 mM PBS buffer 7 37Β°C 0.84 mM Flonicamid 4-(trifluoromethyl)nicotinoyl glycine (TFNG) , N-(4-trifluoromethylnicotinoyl)glycinamide (TFNG-AM) β€” 800 rpm Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (N-(4-trifluoromethylnicotinoyl)glycinamide (TFNG-AM), 4-(trifluoromethyl)nicotinoyl glycine (TFNG) product formation measurement) in the presence of organic solvent Ethanol 2% 100 66 % 50 mM PBS buffer 7 37Β°C 0.84 mM Flonicamid 4-(trifluoromethyl)nicotinoyl glycine (TFNG) , N-(4-trifluoromethylnicotinoyl)glycinamide (TFNG-AM) β€” 800 rpm Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (N-(4-trifluoromethylnicotinoyl)glycinamide (TFNG-AM), 4-(trifluoromethyl)nicotinoyl glycine (TFNG) product formation measurement) in the presence of organic solvent Isopropanol 2% 100 43 % 50 mM PBS buffer 7 37Β°C 0.84 mM Flonicamid 4-(trifluoromethyl)nicotinoyl glycine (TFNG) , N-(4-trifluoromethylnicotinoyl)glycinamide (TFNG-AM) β€” 800 rpm Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (N-(4-trifluoromethylnicotinoyl)glycinamide (TFNG-AM), 4-(trifluoromethyl)nicotinoyl glycine (TFNG) product formation measurement) in the presence of organic solvent 1-Butanol 2% 100 2 % 50 mM PBS buffer 7 37Β°C 0.84 mM Flonicamid 4-(trifluoromethyl)nicotinoyl glycine (TFNG) , N-(4-trifluoromethylnicotinoyl)glycinamide (TFNG-AM) β€” 800 rpm Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (N-(4-trifluoromethylnicotinoyl)glycinamide (TFNG-AM), 4-(trifluoromethyl)nicotinoyl glycine (TFNG) product formation measurement) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 2% 100 79 % 50 mM PBS buffer 7 37Β°C 0.84 mM Flonicamid 4-(trifluoromethyl)nicotinoyl glycine (TFNG) , N-(4-trifluoromethylnicotinoyl)glycinamide (TFNG-AM) β€” 800 rpm Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (N-(4-trifluoromethylnicotinoyl)glycinamide (TFNG-AM), 4-(trifluoromethyl)nicotinoyl glycine (TFNG) product formation measurement) in the presence of organic solvent Acetic Acid 2% 100 2 % 50 mM PBS buffer 7 37Β°C 0.84 mM Flonicamid 4-(trifluoromethyl)nicotinoyl glycine (TFNG) , N-(4-trifluoromethylnicotinoyl)glycinamide (TFNG-AM) β€” 800 rpm Classical aqueous control (in %)

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*