DyP-type peroxidase (gene Efeb) from Bacillus sp. BL5
Enzyme Description
Sequence
MGDEKQQPEQIHRRDILKWGAMAGAAVAIGASGLGGLAPLVQTAAKSSKKDEKEDEQVVPFYGKHQAGITTAHQTYAYFAALDVTAKEKSDIITLFRNWTSLTQMLTSGKKMSAEQKNQYLPPQDTGESVDLSPSNLTVTVGFGPGFFEKDGKDRFGLKNKKPKHLAALPAMPNDNLDEKQGGGDICIQVCADDEQVAFHALRNLLNQAVGTCEVRFVNKGFLSGGKNGETPRNLFGFKDGTGNQSTKDDTLMNSIVWIQSGEPDWMTGGTYMAFRKIKMFLEIWDRSSLKDQEDTFGRRKSSGAPFGQKKETDPVKLNQIPANSHVNLAKSTGKQILRRAFSYTEGLDPKTGYMDAGLLFISFQKNPDNQFIPMLKALSAKDALNEYTQTIGSALYACPGGCKKGEYIAQRLLES
Sanam Islam Khan et al. (2021)
β Cloning, expression and biochemical characterization of lignin-degrading DyP-type peroxidase from Bacillus sp. Strain BL5
Enzyme and Microbial Technology
Β· doi:10.1016/j.enzmictec.2021.109917 β
Β· Stability - Incubation
▼
Database ID
β
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (12 measurements)
12 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (30 minutes at 30Β°C), measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in aqueous phase | Isopropanol | 10% | 100 | 62 | % | Incubation: ?, Assay: 50 mM citrate buffer | Incubation: ?, Assay: 4 | Incubation: 30Β°C, Assay: 30Β°C | 1 mM ABTS, HβOβ (Hydrogen Peroxide) | ABTS radical cation | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 30Β°C), measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in aqueous phase | Isopropanol | 25% | 100 | 48 | % | Incubation: ?, Assay: 50 mM citrate buffer | Incubation: ?, Assay: 4 | Incubation: 30Β°C, Assay: 30Β°C | 1 mM ABTS, HβOβ (Hydrogen Peroxide) | ABTS radical cation | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 30Β°C), measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in aqueous phase | Methanol | 10% | 100 | 128 | % | Incubation: ?, Assay: 50 mM citrate buffer | Incubation: ?, Assay: 4 | Incubation: 30Β°C, Assay: 30Β°C | 1 mM ABTS, HβOβ (Hydrogen Peroxide) | ABTS radical cation | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 30Β°C), measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in aqueous phase | Methanol | 25% | 100 | 135 | % | Incubation: ?, Assay: 50 mM citrate buffer | Incubation: ?, Assay: 4 | Incubation: 30Β°C, Assay: 30Β°C | 1 mM ABTS, HβOβ (Hydrogen Peroxide) | ABTS radical cation | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 30Β°C), measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in aqueous phase | Ethanol | 10% | 100 | 102 | % | Incubation: ?, Assay: 50 mM citrate buffer | Incubation: ?, Assay: 4 | Incubation: 30Β°C, Assay: 30Β°C | 1 mM ABTS, HβOβ (Hydrogen Peroxide) | ABTS radical cation | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 30Β°C), measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in aqueous phase | Ethanol | 25% | 100 | 114 | % | Incubation: ?, Assay: 50 mM citrate buffer | Incubation: ?, Assay: 4 | Incubation: 30Β°C, Assay: 30Β°C | 1 mM ABTS, HβOβ (Hydrogen Peroxide) | ABTS radical cation | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 30Β°C), measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in aqueous phase | 1-Butanol | 10% | 100 | 0 | % | Incubation: ?, Assay: 50 mM citrate buffer | Incubation: ?, Assay: 4 | Incubation: 30Β°C, Assay: 30Β°C | 1 mM ABTS, HβOβ (Hydrogen Peroxide) | ABTS radical cation | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 30Β°C), measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in aqueous phase | 1-Butanol | 25% | 100 | 0 | % | Incubation: ?, Assay: 50 mM citrate buffer | Incubation: ?, Assay: 4 | Incubation: 30Β°C, Assay: 30Β°C | 1 mM ABTS, HβOβ (Hydrogen Peroxide) | ABTS radical cation | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 30Β°C), measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 10% | 100 | 16 | % | Incubation: ?, Assay: 50 mM citrate buffer | Incubation: ?, Assay: 4 | Incubation: 30Β°C, Assay: 30Β°C | 1 mM ABTS, HβOβ (Hydrogen Peroxide) | ABTS radical cation | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 30Β°C), measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 25% | 100 | 0 | % | Incubation: ?, Assay: 50 mM citrate buffer | Incubation: ?, Assay: 4 | Incubation: 30Β°C, Assay: 30Β°C | 1 mM ABTS, HβOβ (Hydrogen Peroxide) | ABTS radical cation | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 30Β°C), measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in aqueous phase | 1,4-Dioxane | 10% | 100 | 36 | % | Incubation: ?, Assay: 50 mM citrate buffer | Incubation: ?, Assay: 4 | Incubation: 30Β°C, Assay: 30Β°C | 1 mM ABTS, HβOβ (Hydrogen Peroxide) | ABTS radical cation | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 30Β°C), measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in aqueous phase | 1,4-Dioxane | 25% | 100 | 0 | % | Incubation: ?, Assay: 50 mM citrate buffer | Incubation: ?, Assay: 4 | Incubation: 30Β°C, Assay: 30Β°C | 1 mM ABTS, HβOβ (Hydrogen Peroxide) | ABTS radical cation | β | β | Non-incubated control (in %), assay in aqueous phase |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.