Trypsin from Bos taurus (bovine)
Enzyme Description
Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Guillermo R. Castro et al. (1999)
β Enzymatic activities of proteases dissolved in organic solvents
Enzyme and Microbial Technology
Β· doi:10.1016/S0141-0229(99)00099-X β
Β· Activity - Michaelis-Menten
▼
Database ID
UniProt: P00760 β
Sequence Annotation
Inferred - from protein name (23 first residues from UniProt sequence absent from the mature protein)
Protein Source
Commercially purchased
Experimental Data (3 measurements)
3 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Michaelis-Menten | Km (mM) measured by HPLC in the presence of organic solvent | Glycerol | 99% | 2.7 | 25.0 | mM | 20 mM phosphate buffer | 7.8 | 30Β°C | Phenyl acetate | Acetic Acid , Phenol | β | β | Classical aqueous control (in mM) |
| Activity - Michaelis-Menten | Vmax (Β΅M/s mg) measured by HPLC in the presence of organic solvent | Glycerol | 99% | 0.46 | 0.17 | Β΅M/(s * mg) | 20 mM phosphate buffer | 7.8 | 30Β°C | Phenyl acetate | Acetic Acid , Phenol | β | β | Classical aqueous control (in microM/(s * mg)) |
| Activity - Michaelis-Menten | Vm/Km (1/s mg) measured by HPLC in the presence of organic solvent | Glycerol | 99% | 0.17 | 0.0068 | 1/(s * mg) | 20 mM phosphate buffer | 7.8 | 30Β°C | Phenyl acetate | Acetic Acid , Phenol | β | β | Classical aqueous control (in 1/(s * mg)) |
Visualization : Activity β Michaelis-Menten
Guillermo R. Castro et al. (1999)
One bar per measurement. Colour = solvent, shade = solvent volume.
L.M. Simon et al. (2001)
β Structure and Activity of Ξ±-Chymotrypsin and Trypsin in Aqueous Organic Media.
Biochemical and Biophysical Research Communications
Β· doi:10.1006/bbrc.2001.4282 β
Β· Activity - Michaelis-Menten Stability - Incubation
▼
Database ID
UniProt: P00760 β
Sequence Annotation
Inferred - from protein name (first 23 residues from UniProt sequence absent from the mature protein)
Protein Source
Commercially purchased
Experimental Data (48 measurements)
48 measurements β page 1 of 3
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Michaelis-Menten | Km (10^-2 * mM) measured by absorbance spectrophotometry (N-benzoyl-L-arginine absorbance measurement, 253 nm) in the presence of organic solvent | Ethanol | 50% | 3.2 | 2.7 | 10^-2 * mM | 46.7 mM Tris-HCl | 8 | 25Β°C | N-benzoyl-L-arginine ethyl ester | Ethanol , N-Benzoyl-L-arginine | β | β | Classical aqueous control (in 10^-2 * mM) |
| Activity - Michaelis-Menten | Km (10^-2 * mM) measured by absorbance spectrophotometry (N-benzoyl-L-arginine absorbance measurement, 253 nm) in the presence of organic solvent | Ethanol | 20% | 3.2 | 2.3 | 10^-2 * mM | 46.7 mM Tris-HCl | 8 | 25Β°C | N-benzoyl-L-arginine ethyl ester | Ethanol , N-Benzoyl-L-arginine | β | β | Classical aqueous control (in 10^-2 * mM) |
| Activity - Michaelis-Menten | Km (10^-2 * mM) measured by absorbance spectrophotometry (N-benzoyl-L-arginine absorbance measurement, 253 nm) in the presence of organic solvent | Acetonitrile | 95% | 3.2 | 2.7 | 10^-2 * mM | 46.7 mM Tris-HCl | 8 | 25Β°C | N-benzoyl-L-arginine ethyl ester | Ethanol , N-Benzoyl-L-arginine | β | β | Classical aqueous control (in 10^-2 * mM) |
| Activity - Michaelis-Menten | Km (10^-2 * mM) measured by absorbance spectrophotometry (N-benzoyl-L-arginine absorbance measurement, 253 nm) in the presence of organic solvent | Acetonitrile | 80% | 3.2 | 2.5 | 10^-2 * mM | 46.7 mM Tris-HCl | 8 | 25Β°C | N-benzoyl-L-arginine ethyl ester | Ethanol , N-Benzoyl-L-arginine | β | β | Classical aqueous control (in 10^-2 * mM) |
| Activity - Michaelis-Menten | Km (10^-2 * mM) measured by absorbance spectrophotometry (N-benzoyl-L-arginine absorbance measurement, 253 nm) in the presence of organic solvent | Acetonitrile | 50% | 3.2 | 2.3 | 10^-2 * mM | 46.7 mM Tris-HCl | 8 | 25Β°C | N-benzoyl-L-arginine ethyl ester | Ethanol , N-Benzoyl-L-arginine | β | β | Classical aqueous control (in 10^-2 * mM) |
| Activity - Michaelis-Menten | Km (10^-2 * mM) measured by absorbance spectrophotometry (N-benzoyl-L-arginine absorbance measurement, 253 nm) in the presence of organic solvent | Acetonitrile | 20% | 3.2 | 2.0 | 10^-2 * mM | 46.7 mM Tris-HCl | 8 | 25Β°C | N-benzoyl-L-arginine ethyl ester | Ethanol , N-Benzoyl-L-arginine | β | β | Classical aqueous control (in 10^-2 * mM) |
| Activity - Michaelis-Menten | Km (10^-2 * mM) measured by absorbance spectrophotometry (N-benzoyl-L-arginine absorbance measurement, 253 nm) in the presence of organic solvent | 1,4-Dioxane | 95% | 3.2 | 3.8 | 10^-2 * mM | 46.7 mM Tris-HCl | 8 | 25Β°C | N-benzoyl-L-arginine ethyl ester | Ethanol , N-Benzoyl-L-arginine | β | β | Classical aqueous control (in 10^-2 * mM) |
| Activity - Michaelis-Menten | Km (10^-2 * mM) measured by absorbance spectrophotometry (N-benzoyl-L-arginine absorbance measurement, 253 nm) in the presence of organic solvent | 1,4-Dioxane | 80% | 3.2 | 2.8 | 10^-2 * mM | 46.7 mM Tris-HCl | 8 | 25Β°C | N-benzoyl-L-arginine ethyl ester | Ethanol , N-Benzoyl-L-arginine | β | β | Classical aqueous control (in 10^-2 * mM) |
| Activity - Michaelis-Menten | Km (10^-2 * mM) measured by absorbance spectrophotometry (N-benzoyl-L-arginine absorbance measurement, 253 nm) in the presence of organic solvent | 1,4-Dioxane | 50% | 3.2 | 2.1 | 10^-2 * mM | 46.7 mM Tris-HCl | 8 | 25Β°C | N-benzoyl-L-arginine ethyl ester | Ethanol , N-Benzoyl-L-arginine | β | β | Classical aqueous control (in 10^-2 * mM) |
| Activity - Michaelis-Menten | Km (10^-2 * mM) measured by absorbance spectrophotometry (N-benzoyl-L-arginine absorbance measurement, 253 nm) in the presence of organic solvent | 1,4-Dioxane | 20% | 3.2 | 1.7 | 10^-2 * mM | 46.7 mM Tris-HCl | 8 | 25Β°C | N-benzoyl-L-arginine ethyl ester | Ethanol , N-Benzoyl-L-arginine | β | β | Classical aqueous control (in 10^-2 * mM) |
| Activity - Michaelis-Menten | Km (10^-2 * mM) measured by absorbance spectrophotometry (N-benzoyl-L-arginine absorbance measurement, 253 nm) in the presence of organic solvent | Ethanol | 95% | 3.2 | 3.4 | 10^-2 * mM | 46.7 mM Tris-HCl | 8 | 25Β°C | N-benzoyl-L-arginine ethyl ester | Ethanol , N-Benzoyl-L-arginine | β | β | Classical aqueous control (in 10^-2 * mM) |
| Activity - Michaelis-Menten | Km (10^-2 * mM) measured by absorbance spectrophotometry (N-benzoyl-L-arginine absorbance measurement, 253 nm) in the presence of organic solvent | Ethanol | 80% | 3.2 | 3.2 | 10^-2 * mM | 46.7 mM Tris-HCl | 8 | 25Β°C | N-benzoyl-L-arginine ethyl ester | Ethanol , N-Benzoyl-L-arginine | β | β | Classical aqueous control (in 10^-2 * mM) |
| Stability - Incubation | Activity after incubation (20 minutes at 25Β°C), measured by absorbance spectrophotometry (N-benzoyl-L-arginine absorbance measurement, 253 nm) in aqueous phase | 1,4-Dioxane | 80% | 100.0 | 32.0 | % | Incubation: Distilled water, Assay: 40 mM Tris-HCl | Incubation: 3, Assay: 8 | Incubation: 25Β°C, Assay: 25Β°C | 0.9 mM N-benzoyl-L-arginine ethyl ester | Ethanol , N-Benzoyl-L-arginine | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (20 minutes at 25Β°C), measured by absorbance spectrophotometry (N-benzoyl-L-arginine absorbance measurement, 253 nm) in aqueous phase | Acetonitrile | 95% | 100.0 | 104.0 | % | Incubation: Distilled water, Assay: 40 mM Tris-HCl | Incubation: 3, Assay: 8 | Incubation: 25Β°C, Assay: 25Β°C | 0.9 mM N-benzoyl-L-arginine ethyl ester | Ethanol , N-Benzoyl-L-arginine | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (20 minutes at 25Β°C), measured by absorbance spectrophotometry (N-benzoyl-L-arginine absorbance measurement, 253 nm) in aqueous phase | 1,4-Dioxane | 85% | 100.0 | 29.0 | % | Incubation: Distilled water, Assay: 40 mM Tris-HCl | Incubation: 3, Assay: 8 | Incubation: 25Β°C, Assay: 25Β°C | 0.9 mM N-benzoyl-L-arginine ethyl ester | Ethanol , N-Benzoyl-L-arginine | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (20 minutes at 25Β°C), measured by absorbance spectrophotometry (N-benzoyl-L-arginine absorbance measurement, 253 nm) in aqueous phase | 1,4-Dioxane | 90% | 100.0 | 29.0 | % | Incubation: Distilled water, Assay: 40 mM Tris-HCl | Incubation: 3, Assay: 8 | Incubation: 25Β°C, Assay: 25Β°C | 0.9 mM N-benzoyl-L-arginine ethyl ester | Ethanol , N-Benzoyl-L-arginine | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (20 minutes at 25Β°C), measured by absorbance spectrophotometry (N-benzoyl-L-arginine absorbance measurement, 253 nm) in aqueous phase | 1,4-Dioxane | 92.5% | 100.0 | 48.0 | % | Incubation: Distilled water, Assay: 40 mM Tris-HCl | Incubation: 3, Assay: 8 | Incubation: 25Β°C, Assay: 25Β°C | 0.9 mM N-benzoyl-L-arginine ethyl ester | Ethanol , N-Benzoyl-L-arginine | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (20 minutes at 25Β°C), measured by absorbance spectrophotometry (N-benzoyl-L-arginine absorbance measurement, 253 nm) in aqueous phase | 1,4-Dioxane | 95% | 100.0 | 62.0 | % | Incubation: Distilled water, Assay: 40 mM Tris-HCl | Incubation: 3, Assay: 8 | Incubation: 25Β°C, Assay: 25Β°C | 0.9 mM N-benzoyl-L-arginine ethyl ester | Ethanol , N-Benzoyl-L-arginine | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (20 minutes at 25Β°C), measured by absorbance spectrophotometry (N-benzoyl-L-arginine absorbance measurement, 253 nm) in aqueous phase | Acetonitrile | 10% | 100.0 | 98.0 | % | Incubation: Distilled water, Assay: 40 mM Tris-HCl | Incubation: 3, Assay: 8 | Incubation: 25Β°C, Assay: 25Β°C | 0.9 mM N-benzoyl-L-arginine ethyl ester | Ethanol , N-Benzoyl-L-arginine | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (20 minutes at 25Β°C), measured by absorbance spectrophotometry (N-benzoyl-L-arginine absorbance measurement, 253 nm) in aqueous phase | Acetonitrile | 20% | 100.0 | 102.0 | % | Incubation: Distilled water, Assay: 40 mM Tris-HCl | Incubation: 3, Assay: 8 | Incubation: 25Β°C, Assay: 25Β°C | 0.9 mM N-benzoyl-L-arginine ethyl ester | Ethanol , N-Benzoyl-L-arginine | β | β | Non-incubated control (in %), assay in aqueous phase |
Visualization : Activity β Michaelis-Menten
L.M. Simon et al. (2001)
One bar per measurement. Colour = solvent, shade = solvent volume.
Visualization : Stability β Incubation
L.M. Simon et al. (2001)
One bar per measurement. Colour = solvent, shade = solvent volume.
Andrew M.J. Crowell et al. (2013)
β Critical assessment of the spectroscopic activity assay for monitoring trypsin activity in organicβaqueous solvent
Analytical Biochemistry
Β· doi:10.1016/j.ab.2012.12.019 β
Β· Activity - Classical
▼
Database ID
UniProt: P00760 β
Sequence Annotation
Inferred - from protein name (23 first residues from UniProt sequence absent from the mature protein)
Protein Source
Commercially purchased
Experimental Data (14 measurements)
14 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Activity measured by absorbance spectrophotometry (Benzoyl-L-arginine ethyl ester/NΞ±-benzoyl-L-arginine absorbance measurement, 253 nm) in the presence of organic solvent | Acetonitrile | 10% | 100 | 122 | % | 100 mM Tris-HCl | 8 | 37Β°C | 0.26 mM Benzoyl-L-arginine ethyl ester | Ethanol , NΞ±-benzoyl-L-arginine | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (Benzoyl-L-arginine ethyl ester/NΞ±-benzoyl-L-arginine absorbance measurement, 253 nm) in the presence of organic solvent | Acetonitrile | 20% | 100 | 112 | % | 100 mM Tris-HCl | 8 | 37Β°C | 0.26 mM Benzoyl-L-arginine ethyl ester | Ethanol , NΞ±-benzoyl-L-arginine | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (Benzoyl-L-arginine ethyl ester/NΞ±-benzoyl-L-arginine absorbance measurement, 253 nm) in the presence of organic solvent | Acetonitrile | 30% | 100 | 81 | % | 100 mM Tris-HCl | 8 | 37Β°C | 0.26 mM Benzoyl-L-arginine ethyl ester | Ethanol , NΞ±-benzoyl-L-arginine | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (Benzoyl-L-arginine ethyl ester/NΞ±-benzoyl-L-arginine absorbance measurement, 253 nm) in the presence of organic solvent | Acetonitrile | 40% | 100 | 44 | % | 100 mM Tris-HCl | 8 | 37Β°C | 0.26 mM Benzoyl-L-arginine ethyl ester | Ethanol , NΞ±-benzoyl-L-arginine | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (Benzoyl-L-arginine ethyl ester/NΞ±-benzoyl-L-arginine absorbance measurement, 253 nm) in the presence of organic solvent | Acetonitrile | 50% | 100 | 36 | % | 100 mM Tris-HCl | 8 | 37Β°C | 0.26 mM Benzoyl-L-arginine ethyl ester | Ethanol , NΞ±-benzoyl-L-arginine | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (Benzoyl-L-arginine ethyl ester/NΞ±-benzoyl-L-arginine absorbance measurement, 253 nm) in the presence of organic solvent | Acetonitrile | 60% | 100 | 28 | % | 100 mM Tris-HCl | 8 | 37Β°C | 0.26 mM Benzoyl-L-arginine ethyl ester | Ethanol , NΞ±-benzoyl-L-arginine | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (Benzoyl-L-arginine ethyl ester/NΞ±-benzoyl-L-arginine absorbance measurement, 253 nm) in the presence of organic solvent | Acetonitrile | 70% | 100 | 20 | % | 100 mM Tris-HCl | 8 | 37Β°C | 0.26 mM Benzoyl-L-arginine ethyl ester | Ethanol , NΞ±-benzoyl-L-arginine | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-toluenesulfonyl-L-arginine methyl ester /NΞ±-p-Toluenesulfonyl-L-arginin absorbance measurement, 247 nm) in the presence of organic solvent | Acetonitrile | 10% | 100 | 127 | % | 100 mM Tris-HCl | 8 | 37Β°C | 1.1 mM p-toluenesulfonyl-L-arginine methyl ester | Methanol , NΞ±-p-Toluenesulfonyl-L-arginin | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-toluenesulfonyl-L-arginine methyl ester /NΞ±-p-Toluenesulfonyl-L-arginin absorbance measurement, 247 nm) in the presence of organic solvent | Acetonitrile | 20% | 100 | 138 | % | 100 mM Tris-HCl | 8 | 37Β°C | 1.1 mM p-toluenesulfonyl-L-arginine methyl ester | Methanol , NΞ±-p-Toluenesulfonyl-L-arginin | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-toluenesulfonyl-L-arginine methyl ester /NΞ±-p-Toluenesulfonyl-L-arginin absorbance measurement, 247 nm) in the presence of organic solvent | Acetonitrile | 30% | 100 | 114 | % | 100 mM Tris-HCl | 8 | 37Β°C | 1.1 mM p-toluenesulfonyl-L-arginine methyl ester | Methanol , NΞ±-p-Toluenesulfonyl-L-arginin | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-toluenesulfonyl-L-arginine methyl ester /NΞ±-p-Toluenesulfonyl-L-arginin absorbance measurement, 247 nm) in the presence of organic solvent | Acetonitrile | 40% | 100 | 85 | % | 100 mM Tris-HCl | 8 | 37Β°C | 1.1 mM p-toluenesulfonyl-L-arginine methyl ester | Methanol , NΞ±-p-Toluenesulfonyl-L-arginin | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-toluenesulfonyl-L-arginine methyl ester /NΞ±-p-Toluenesulfonyl-L-arginin absorbance measurement, 247 nm) in the presence of organic solvent | Acetonitrile | 50% | 100 | 77 | % | 100 mM Tris-HCl | 8 | 37Β°C | 1.1 mM p-toluenesulfonyl-L-arginine methyl ester | Methanol , NΞ±-p-Toluenesulfonyl-L-arginin | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-toluenesulfonyl-L-arginine methyl ester /NΞ±-p-Toluenesulfonyl-L-arginin absorbance measurement, 247 nm) in the presence of organic solvent | Acetonitrile | 60% | 100 | 60 | % | 100 mM Tris-HCl | 8 | 37Β°C | 1.1 mM p-toluenesulfonyl-L-arginine methyl ester | Methanol , NΞ±-p-Toluenesulfonyl-L-arginin | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-toluenesulfonyl-L-arginine methyl ester /NΞ±-p-Toluenesulfonyl-L-arginin absorbance measurement, 247 nm) in the presence of organic solvent | Acetonitrile | 70% | 100 | 42 | % | 100 mM Tris-HCl | 8 | 37Β°C | 1.1 mM p-toluenesulfonyl-L-arginine methyl ester | Methanol , NΞ±-p-Toluenesulfonyl-L-arginin | β | β | Classical aqueous control (in %) |
Visualization : Activity β Classical
Andrew M.J. Crowell et al. (2013)
One bar per measurement. Colour = solvent, shade = solvent volume.