Esterase B from Jatropha curcas
Enzyme Description
Sequence
MVGVDFEIKNHAVKISQLEPGYRALIPDLYRGKVGLDVAEAQHLMEDLDWQSVVKDIRASVNWLKANGSKKVGVTGFCMGGALSIASSVLVPEVDAVVAFYGVPSSELADPAQAKAPIQAHFGELDNFVGFSDVTAAKALEEKLKASGIPYEVHIYPGSAHAFMNRSEEGIKRRKGMGMPDDNEAAAQLAWSRFSSWMGRYLSA
Marcos Gustavo Araujo Schwarz et al. (2021)
β Revisiting Jatropha curcas Monomeric Esterase: A Dienelactone Hydrolase Compatible with the Electrostatic Catapult Model
▼
Database ID
UniProt: A0A067JLI6 β
Sequence Annotation
Explicit - Provided
Protein Source
Purified, eukaryote Jatropha curcas
Experimental Data (16 measurements)
16 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 348 nm) in the presence of organic solvent | Isopropanol | 10% | 0.18 | 0.09 | U/mL | 100 mM Tris-HCl buffer | 7.5 | Room temperature | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in U/mL) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 348 nm) in the presence of organic solvent | Isopropanol | 20% | 0.18 | 0.08 | U/mL | 100 mM Tris-HCl buffer | 7.5 | Room temperature | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in U/mL) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 348 nm) in the presence of organic solvent | Isopropanol | 40% | 0.18 | 0.07 | U/mL | 100 mM Tris-HCl buffer | 7.5 | Room temperature | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in U/mL) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 348 nm) in the presence of organic solvent | Isopropanol | 60% | 0.18 | 0.03 | U/mL | 100 mM Tris-HCl buffer | 7.5 | Room temperature | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in U/mL) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 348 nm) in the presence of organic solvent | Acetonitrile | 10% | 0.18 | 0.07 | U/mL | 100 mM Tris-HCl buffer | 7.5 | Room temperature | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in U/mL) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 348 nm) in the presence of organic solvent | Acetonitrile | 20% | 0.18 | 0.05 | U/mL | 100 mM Tris-HCl buffer | 7.5 | Room temperature | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in U/mL) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 348 nm) in the presence of organic solvent | Acetonitrile | 40% | 0.18 | 0.02 | U/mL | 100 mM Tris-HCl buffer | 7.5 | Room temperature | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in U/mL) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 348 nm) in the presence of organic solvent | Acetonitrile | 60% | 0.18 | 0.0 | U/mL | 100 mM Tris-HCl buffer | 7.5 | Room temperature | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in U/mL) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 348 nm) in the presence of organic solvent | Ethanol | 10% | 0.18 | 0.12 | U/mL | 100 mM Tris-HCl buffer | 7.5 | Room temperature | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in U/mL) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 348 nm) in the presence of organic solvent | Ethanol | 20% | 0.18 | 0.03 | U/mL | 100 mM Tris-HCl buffer | 7.5 | Room temperature | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in U/mL) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 348 nm) in the presence of organic solvent | Ethanol | 40% | 0.18 | 0.01 | U/mL | 100 mM Tris-HCl buffer | 7.5 | Room temperature | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in U/mL) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 348 nm) in the presence of organic solvent | Ethanol | 60% | 0.18 | 0.01 | U/mL | 100 mM Tris-HCl buffer | 7.5 | Room temperature | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in U/mL) |
| Stability - Incubation | Activity after incubation (30 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 348 nm) in aqueous phase | Isopropanol | 10% | 0.18 | 0.17 | U/mL | Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer | Incubation: 7.5, Assay: 7.5 | Incubation: Room temperature, Assay: Room temperature | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in U/mL), assay in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 348 nm) in aqueous phase | Isopropanol | 40% | 0.18 | 0.18 | U/mL | Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer | Incubation: 7.5, Assay: 7.5 | Incubation: Room temperature, Assay: Room temperature | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in U/mL), assay in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 348 nm) in aqueous phase | Acetonitrile | 10% | 0.18 | 0.18 | U/mL | Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer | Incubation: 7.5, Assay: 7.5 | Incubation: Room temperature, Assay: Room temperature | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in U/mL), assay in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 348 nm) in aqueous phase | Acetonitrile | 40% | 0.18 | 0.17 | U/mL | Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer | Incubation: 7.5, Assay: 7.5 | Incubation: Room temperature, Assay: Room temperature | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in U/mL), assay in aqueous phase | Clear about assay in aqueous phase |
Visualization : Activity β Classical
One bar per measurement. Colour = solvent, shade = solvent volume.
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.