Serine protease SAPA from Anoxybacillus kamchatkensis M1V

Enzyme Description

Species

Anoxybacillus kamchatkensis M1V ↗

Extremophile

Yes thermophilic organism

EC Number

3.4.- ↗

Sequence

Length: 385 amino acids

MNNKMLLVIIMSLIFFTFNIPKTFADNNHEQRYFVTFKEEVDTDYIKEKEGKIIRQFNTSSSVLIEASSETIQRIKDNNEIVSIELDVEVEIDEAYETDWGLIDIDPQEQLIPWNIDYIGSTYAHQIDITGKNVKVGIIDSGINPHKDLKVSGGINIVGNNGNYYDDYGHGTKVAGIIAALDNSYGIIGVAPDVELYSIKVLKSNGKGSISDVVAGIEWAIENDIDILNFSLQTTIDNSVLRNAIQKAYENNILLVASAGNMGGTKKVDTVTYPAAYDEVIAVAAVDKNGERASYSSTGKRIDISAPGDYVYTTVQSGLYFLATGTSMAAPHVSGVAALVLECQPNLDVEELRKILLKSKKPFGNPKLYGKGIIDVPKAIKFSKN

Akli Ouelhadj et al. (2020) — Identification and homology modeling of a new biotechnologically compatible serine alkaline protease from moderately halotolerant Gracilibacillus boraciitolerans strain LO15

International Journal of Biological Macromolecules · doi:10.1016/j.ijbiomac.2020.07.266 ↗ · Activity - Classical

10 measurements ▼

Database ID

UniParc: UPI0007B4CD98 ↗

Sequence Annotation

Explicit - Provided GenBank Accession Number

Protein Source

Experimental Data (10 measurements)

10 measurements

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent	n-Decane	25%	100	72	%	83 mM glycine-NaOH buffer	10	60°C	0.8% Casein	free amino acids , Peptides	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent	n-Octane	25%	100	120	%	83 mM glycine-NaOH buffer	10	60°C	0.8% Casein	free amino acids , Peptides	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent	n-Hexane	25%	100	99	%	83 mM glycine-NaOH buffer	10	60°C	0.8% Casein	free amino acids , Peptides	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent	Toluene	25%	100	79	%	83 mM glycine-NaOH buffer	10	60°C	0.8% Casein	free amino acids , Peptides	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent	Chloroform	25%	100	122	%	83 mM glycine-NaOH buffer	10	60°C	0.8% Casein	free amino acids , Peptides	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent	1-Butanol	25%	100	104	%	83 mM glycine-NaOH buffer	10	60°C	0.8% Casein	free amino acids , Peptides	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent	Isopropanol	25%	100	99	%	83 mM glycine-NaOH buffer	10	60°C	0.8% Casein	free amino acids , Peptides	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent	Acetonitrile	25%	100	0	%	83 mM glycine-NaOH buffer	10	60°C	0.8% Casein	free amino acids , Peptides	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent	Methanol	25%	100	111	%	83 mM glycine-NaOH buffer	10	60°C	0.8% Casein	free amino acids , Peptides	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	25%	100	107	%	83 mM glycine-NaOH buffer	10	60°C	0.8% Casein	free amino acids , Peptides	—	—	Classical aqueous control (in %)

Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent	n-Decane	25%	100	72	%	83 mM glycine-NaOH buffer	10	60°C	0.8% Casein	free amino acids, Peptides	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent	n-Octane	25%	100	120	%	83 mM glycine-NaOH buffer	10	60°C	0.8% Casein	free amino acids, Peptides	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent	n-Hexane	25%	100	99	%	83 mM glycine-NaOH buffer	10	60°C	0.8% Casein	free amino acids, Peptides	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent	Toluene	25%	100	79	%	83 mM glycine-NaOH buffer	10	60°C	0.8% Casein	free amino acids, Peptides	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent	Chloroform	25%	100	122	%	83 mM glycine-NaOH buffer	10	60°C	0.8% Casein	free amino acids, Peptides	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent	1-Butanol	25%	100	104	%	83 mM glycine-NaOH buffer	10	60°C	0.8% Casein	free amino acids, Peptides	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent	Isopropanol	25%	100	99	%	83 mM glycine-NaOH buffer	10	60°C	0.8% Casein	free amino acids, Peptides	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent	Acetonitrile	25%	100	0	%	83 mM glycine-NaOH buffer	10	60°C	0.8% Casein	free amino acids, Peptides	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent	Methanol	25%	100	111	%	83 mM glycine-NaOH buffer	10	60°C	0.8% Casein	free amino acids, Peptides	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	25%	100	107	%	83 mM glycine-NaOH buffer	10	60°C	0.8% Casein	free amino acids, Peptides	—	—	Classical aqueous control (in %)

Visualization : Activity — Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate · Scroll to zoom · Right-click drag to pan · Powered by Mol*