Esterase DS-007 from a hot spring metaproteomic library
Enzyme Description
Species
Na (hot spring metaproteomic library)
Extremophile
Yes
organism from hot spring, thermophilic enzyme
EC Number
Sequence
MNVHTEERLIPGPVGQIDLSIDQPDTALRGLALIGHPHPLFGGTKDNKVAQTLARTFVGLGYATVRLNFRGVGKTEGTHDNGIGEQDDMLAVLDWMRTQTEWSADVATLPLALGGFSFGSFVVSQVARRLAEAGTPAERLALVGTATSRWDVAPVPADTIIIHGEQDDTVPLIDVLNWARPQELPVIVIPGADHFFHRKLHLIRQLITGAWAPKP
Dennis Sander et al. (2021)
β Metaproteomic Discovery and Characterization of a Novel Lipolytic Enzyme From an Indian Hot Spring
Frontiers in Microbiology
Β· doi:10.3389/fmicb.2021.672727 β
Β· Activity - Classical
▼
Database ID
UniProt: A0ABM9IQU0 β
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (15 measurements)
15 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Methanol | 1% | 16.7 | 24.0 | Β΅mol * Β΅gram^-1 * min^-1 | 50 mM sodium phosphate buffer assay | 9.5 | 55Β°C | ? mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in micromol * microgram^-1 * min^-1) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Methanol | 10% | 16.7 | 8.4 | Β΅mol * Β΅gram^-1 * min^-1 | 50 mM sodium phosphate buffer assay | 9.5 | 55Β°C | ? mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in micromol * microgram^-1 * min^-1) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Methanol | 20% | 16.7 | 0.0 | Β΅mol * Β΅gram^-1 * min^-1 | 50 mM sodium phosphate buffer assay | 9.5 | 55Β°C | ? mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in micromol * microgram^-1 * min^-1) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 1% | 16.7 | 13.4 | Β΅mol * Β΅gram^-1 * min^-1 | 50 mM sodium phosphate buffer assay | 9.5 | 55Β°C | ? mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in micromol * microgram^-1 * min^-1) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 10% | 16.7 | 8.2 | Β΅mol * Β΅gram^-1 * min^-1 | 50 mM sodium phosphate buffer assay | 9.5 | 55Β°C | ? mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in micromol * microgram^-1 * min^-1) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 20% | 16.7 | 3.0 | Β΅mol * Β΅gram^-1 * min^-1 | 50 mM sodium phosphate buffer assay | 9.5 | 55Β°C | ? mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in micromol * microgram^-1 * min^-1) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Dimethylformamide (DMF) | 1% | 16.7 | 9.3 | Β΅mol * Β΅gram^-1 * min^-1 | 50 mM sodium phosphate buffer assay | 9.5 | 55Β°C | ? mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in micromol * microgram^-1 * min^-1) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Dimethylformamide (DMF) | 10% | 16.7 | 0.2 | Β΅mol * Β΅gram^-1 * min^-1 | 50 mM sodium phosphate buffer assay | 9.5 | 55Β°C | ? mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in micromol * microgram^-1 * min^-1) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Dimethylformamide (DMF) | 20% | 16.7 | 0.0 | Β΅mol * Β΅gram^-1 * min^-1 | 50 mM sodium phosphate buffer assay | 9.5 | 55Β°C | ? mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in micromol * microgram^-1 * min^-1) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Isopropanol | 1% | 16.7 | 11.9 | Β΅mol * Β΅gram^-1 * min^-1 | 50 mM sodium phosphate buffer assay | 9.5 | 55Β°C | ? mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in micromol * microgram^-1 * min^-1) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Isopropanol | 10% | 16.7 | 8.7 | Β΅mol * Β΅gram^-1 * min^-1 | 50 mM sodium phosphate buffer assay | 9.5 | 55Β°C | ? mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in micromol * microgram^-1 * min^-1) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Isopropanol | 20% | 16.7 | 0.1 | Β΅mol * Β΅gram^-1 * min^-1 | 50 mM sodium phosphate buffer assay | 9.5 | 55Β°C | ? mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in micromol * microgram^-1 * min^-1) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Acetone | 1% | 16.7 | 11.2 | Β΅mol * Β΅gram^-1 * min^-1 | 50 mM sodium phosphate buffer assay | 9.5 | 55Β°C | ? mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in micromol * microgram^-1 * min^-1) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Acetone | 10% | 16.7 | 0.6 | Β΅mol * Β΅gram^-1 * min^-1 | 50 mM sodium phosphate buffer assay | 9.5 | 55Β°C | ? mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in micromol * microgram^-1 * min^-1) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Acetone | 20% | 16.7 | 0.0 | Β΅mol * Β΅gram^-1 * min^-1 | 50 mM sodium phosphate buffer assay | 9.5 | 55Β°C | ? mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in micromol * microgram^-1 * min^-1) |
Visualization : Activity β Classical
One bar per measurement. Colour = solvent, shade = solvent volume.