Amidase (gene amiA) from Microvirga flocculans CGMCC 1.16731

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 432 amino acids
MTTTRDKLETILARLAGRAADERVFLRVYEDAARIAADAADARRRGGLSLGPLDGAIVSIKDLFDVAGETTLAGSIALRDAPPADRDAAIVRRLRQAGAVIIGRTNMVEFAFSGLGLNPHYGTPGNAADPLRIPGGSSSGAGVSVAEGTSEISIGSDTGGSVRIPAALNGVVGFKPTAHRVPLDGTFPLAPSLDSIGPLARNVQDCAFTDAVMAGEDPRVLKPQPLAGLRIGVPRGRLFTQTEPMVEQAFEDSLTRLSEAGARIADHGIEDLLEAMAQITETASIASIEASEVHADWLNAKAAEIDPRVRWWIARSSTVPAPTYIRMLRRRRVLAAAMDERLSPIDVLALPATAIPAPLIAPFEGDDKLYNKMDGLILRNTMFGNQFDLTAISLPVPGTALPVGLMLVARHGHDRRLLEIAAGVETLLARGA
Yun-Xiu Zhao et al. (2021) β€” Biodegradation of the pyridinecarboxamide insecticide flonicamid by Microvirga flocculans and characterization of two novel amidases involved
Ecotoxicology and Environmental Safety  Β· doi:10.1016/j.ecoenv.2021.112384 β†—  Β· Activity - Classical
7 measurements
Database ID
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli Rosetta (DE3) pLys

Experimental Data (7 measurements)

7 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by HPLC (4-(trifluoromethyl) nicotinol glycine formation) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) ?% 100 94 % ? 6 50Β°C 0.75 mM N-(4-Trifluoromethylnicotinoyl)glycinamide glycinamide 4-(trifluoromethyl) nicotinol glycine β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (4-(trifluoromethyl) nicotinol glycine formation) in the presence of organic solvent Acetone ?% 100 71 % ? 6 50Β°C 0.75 mM N-(4-Trifluoromethylnicotinoyl)glycinamide glycinamide 4-(trifluoromethyl) nicotinol glycine β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (4-(trifluoromethyl) nicotinol glycine formation) in the presence of organic solvent 1-Butanol ?% 100 53 % ? 6 50Β°C 0.75 mM N-(4-Trifluoromethylnicotinoyl)glycinamide glycinamide 4-(trifluoromethyl) nicotinol glycine β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (4-(trifluoromethyl) nicotinol glycine formation) in the presence of organic solvent Methanol ?% 100 93 % ? 6 50Β°C 0.75 mM N-(4-Trifluoromethylnicotinoyl)glycinamide glycinamide 4-(trifluoromethyl) nicotinol glycine β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (4-(trifluoromethyl) nicotinol glycine formation) in the presence of organic solvent Ethanol ?% 100 86 % ? 6 50Β°C 0.75 mM N-(4-Trifluoromethylnicotinoyl)glycinamide glycinamide 4-(trifluoromethyl) nicotinol glycine β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (4-(trifluoromethyl) nicotinol glycine formation) in the presence of organic solvent Ethyl Acetate ?% 100 77 % ? 6 50Β°C 0.75 mM N-(4-Trifluoromethylnicotinoyl)glycinamide glycinamide 4-(trifluoromethyl) nicotinol glycine β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (4-(trifluoromethyl) nicotinol glycine formation) in the presence of organic solvent Isopropanol ?% 100 78 % ? 6 50Β°C 0.75 mM N-(4-Trifluoromethylnicotinoyl)glycinamide glycinamide 4-(trifluoromethyl) nicotinol glycine β€” β€” Classical aqueous control (in %)

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*