Thioesterase (UniParc : UPI0010B6B271) from a hot spring metagenomic library
Enzyme Description
Species
Na (hot spring metagenomic library)
Extremophile
Yes
organism from hot spring, thermophilic enzyme
EC Number
Sequence
MSLGGSMALYSKSYRVYWSETDAALMMHFSNFFRVCERTEEEFLRSLGFEQHGTGSQAIGSSCQGFAECDYRSPLRPGDMYRVDIVDIVMGSSSLRWHYEIYNETRGELSATCEIVTVAYDESLGKSVPIPDEIREKLMKAGARPREALVSGS
Suharti et al. (2021)
β Cloning, heterologous expression, and characterization of a novel thioesterase from natural sample
Heliyon
Β· doi:10.1016/j.heliyon.2021.e06542 β
Β· Activity - Classical
▼
Database ID
UniParc: UPI0010B6B271 β
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (8 measurements)
8 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 412 nm) in the presence of organic solvent | Methanol | 3% | 100.0 | 18.0 | % | 37.5 mM sodium phospahte buffer, 3% Ethanol | 8 | 80Β°C | 0.075 mM p-Nitrophenyl decanoate | Decanoic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 412 nm) in the presence of organic solvent | Ethanol | 3% | 100.0 | 15.2 | % | 37.5 mM sodium phospahte buffer, 3% Ethanol | 8 | 80Β°C | 0.075 mM p-Nitrophenyl decanoate | Decanoic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 412 nm) in the presence of organic solvent | 1-Butanol | 3% | 100.0 | 14.8 | % | 37.5 mM sodium phospahte buffer, 3% Ethanol | 8 | 80Β°C | 0.075 mM p-Nitrophenyl decanoate | Decanoic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 412 nm) in the presence of organic solvent | Isopropanol | 3% | 100.0 | 10.0 | % | 37.5 mM sodium phospahte buffer, 3% Ethanol | 8 | 80Β°C | 0.075 mM p-Nitrophenyl decanoate | Decanoic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 412 nm) in the presence of organic solvent | Acetonitrile | 3% | 100.0 | 6.4 | % | 37.5 mM sodium phospahte buffer, 3% Ethanol | 8 | 80Β°C | 0.075 mM p-Nitrophenyl decanoate | Decanoic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 412 nm) in the presence of organic solvent | Acetone | 3% | 100.0 | 3.7 | % | 37.5 mM sodium phospahte buffer, 3% Ethanol | 8 | 80Β°C | 0.075 mM p-Nitrophenyl decanoate | Decanoic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 412 nm) in the presence of organic solvent | Chloroform | 3% | 100.0 | 3.6 | % | 37.5 mM sodium phospahte buffer, 3% Ethanol | 8 | 80Β°C | 0.075 mM p-Nitrophenyl decanoate | Decanoic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 412 nm) in the presence of organic solvent | n-Hexane | 3% | 100.0 | 2.8 | % | 37.5 mM sodium phospahte buffer, 3% Ethanol | 8 | 80Β°C | 0.075 mM p-Nitrophenyl decanoate | Decanoic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
Visualization : Activity β Classical
One bar per measurement. Colour = solvent, shade = solvent volume.