Thioesterase (UniParc : UPI0010B6B271) from a hot spring metagenomic library

Enzyme Description

Species
Na (hot spring metagenomic library)
Extremophile
Yes organism from hot spring, thermophilic enzyme
EC Number

Sequence

Length: 153 amino acids
MSLGGSMALYSKSYRVYWSETDAALMMHFSNFFRVCERTEEEFLRSLGFEQHGTGSQAIGSSCQGFAECDYRSPLRPGDMYRVDIVDIVMGSSSLRWHYEIYNETRGELSATCEIVTVAYDESLGKSVPIPDEIREKLMKAGARPREALVSGS
Suharti et al. (2021) β€” Cloning, heterologous expression, and characterization of a novel thioesterase from natural sample
Heliyon  Β· doi:10.1016/j.heliyon.2021.e06542 β†—  Β· Activity - Classical
8 measurements
Database ID
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (8 measurements)

8 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 412 nm) in the presence of organic solvent Methanol 3% 100.0 18.0 % 37.5 mM sodium phospahte buffer, 3% Ethanol 8 80Β°C 0.075 mM p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 412 nm) in the presence of organic solvent Ethanol 3% 100.0 15.2 % 37.5 mM sodium phospahte buffer, 3% Ethanol 8 80Β°C 0.075 mM p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 412 nm) in the presence of organic solvent 1-Butanol 3% 100.0 14.8 % 37.5 mM sodium phospahte buffer, 3% Ethanol 8 80Β°C 0.075 mM p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 412 nm) in the presence of organic solvent Isopropanol 3% 100.0 10.0 % 37.5 mM sodium phospahte buffer, 3% Ethanol 8 80Β°C 0.075 mM p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 412 nm) in the presence of organic solvent Acetonitrile 3% 100.0 6.4 % 37.5 mM sodium phospahte buffer, 3% Ethanol 8 80Β°C 0.075 mM p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 412 nm) in the presence of organic solvent Acetone 3% 100.0 3.7 % 37.5 mM sodium phospahte buffer, 3% Ethanol 8 80Β°C 0.075 mM p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 412 nm) in the presence of organic solvent Chloroform 3% 100.0 3.6 % 37.5 mM sodium phospahte buffer, 3% Ethanol 8 80Β°C 0.075 mM p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 412 nm) in the presence of organic solvent n-Hexane 3% 100.0 2.8 % 37.5 mM sodium phospahte buffer, 3% Ethanol 8 80Β°C 0.075 mM p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*