Lipase LK4 from a compost metagenomic library

Enzyme Description

Species
Na (compost metagenomic library)
Extremophile
No
EC Number
3.1.1.3 β†—

Sequence

Length: 311 amino acids
MNKNKTLLALCLGSALALSGQAFAATGSGYTATKYPIVLAHGMLGFDSLLGIDYWYGIPSALRRDGAQVYVTEVSQLNTSELRGEELLAQVEEIVAISGKPKVNLIGHSHGGPTIRYVAGVRPDLIASVTSVGAPHKGSDVADLIRKVPEGSSGEAIIAGLVNAMGAFINFVSGSSSTAPQNSQGSLESLNSEGAARFNAKFPHGIPTTACGEGAYKVDGVHYYSWSGTSPLTNPLDVSDAMMGAGSLAFSGPNDGLVGRCSSHLGMVIRDNYRMNHLDEVNQFMGLTSLFETDPVSVYRQHANRLKNAGL
Ilma Fauziah Ma 'ruf et al. (2021) β€” Effect of mutation at oxyanion hole residu (H110F) on activity of Lk4 lipase
Biotechnology Reports  Β· doi:10.1016/j.btre.2021.e00590 β†—  Β· Activity - Classical
14 measurements ▼
Database ID
UniProt: A0A0E3M1J0 β†—
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (14 measurements)

14 measurements
Mutation Property Assay Solvent Solvent Volume Aqueous ReferenceWT Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
WT Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent Ethanol 3% 100 β€” 33 % 37.5 mM sodium phosphate buffer, 3% Ethanol 9 40Β°C 0.3 mM p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
WT Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent Methanol 3% 100 β€” 32 % 37.5 mM sodium phosphate buffer, 3% Ethanol 9 40Β°C 0.3 mM p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
WT Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent 1-Propanol 3% 100 β€” 39 % 37.5 mM sodium phosphate buffer, 3% Ethanol 9 40Β°C 0.3 mM p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
WT Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent Acetonitrile 3% 100 β€” 30 % 37.5 mM sodium phosphate buffer, 3% Ethanol 9 40Β°C 0.3 mM p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
WT Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent Acetone 3% 100 β€” 24 % 37.5 mM sodium phosphate buffer, 3% Ethanol 9 40Β°C 0.3 mM p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
WT Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent Chloroform 3% 100 β€” 0 % 37.5 mM sodium phosphate buffer, 3% Ethanol 9 40Β°C 0.3 mM p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
WT Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent n-Hexane 3% 100 β€” 0 % 37.5 mM sodium phosphate buffer, 3% Ethanol 9 40Β°C 0.3 mM p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
H110F Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent Ethanol 3% 100 33 100 % 37.5 mM sodium phosphate buffer, 3% Ethanol 9 40Β°C 0.3 mM p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
H110F Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent Methanol 3% 100 32 99 % 37.5 mM sodium phosphate buffer, 3% Ethanol 9 40Β°C 0.3 mM p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
H110F Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent 1-Propanol 3% 100 39 110 % 37.5 mM sodium phosphate buffer, 3% Ethanol 9 40Β°C 0.3 mM p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
H110F Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent Acetonitrile 3% 100 30 106 % 37.5 mM sodium phosphate buffer, 3% Ethanol 9 40Β°C 0.3 mM p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
H110F Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent Acetone 3% 100 24 87 % 37.5 mM sodium phosphate buffer, 3% Ethanol 9 40Β°C 0.3 mM p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
H110F Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent Chloroform 3% 100 10 10 % 37.5 mM sodium phosphate buffer, 3% Ethanol 9 40Β°C 0.3 mM p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
H110F Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent n-Hexane 3% 100 0 51 % 37.5 mM sodium phosphate buffer, 3% Ethanol 9 40Β°C 0.3 mM p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)

Mutations in this dataset (2)

WT H110F

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume. β€” β€” β€” Reference value. Hover for details.

Mutation Effect

Mutation impact on enzyme stability and function in the presence of organic solvent: comparison of wild-type and mutant values in identical conditions.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*