Subtilisin from Bacillus amyloliquefaciens HM48

Enzyme Description

Extremophile
No but "thermostable" and "alkalistable" organism
EC Number

Sequence

Length: 209 amino acids
SNVKVAVIDSGIDSSHPDLNVAGGASMVPSETNPFQDSNSHGTHVAGTVAALNNSIGVLGVAPSASLYAVKVLGADGSGQYSWIINGIEWAIANNMDVINMSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGTSGSSSTVGYPGKYPSVIAVGAVDSSNQRASFSSVGPELDVMAPGVSIQSTLPGNKYGAYNGTSMASPHVAGAPP
Hina Mushtaq et al. (2021) β€” Biochemical Characterization and Functional Analysis of Heat Stable High Potential Protease of Bacillus amyloliquefaciens Strain HM48 from Soils of Dachigam National Park in Kashmir Himalaya
Biomolecules  Β· doi:10.3390/biom11010117 β†—  Β· Activity - Classical Stability - Incubation
6 measurements
Database ID
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Purified, bacterium Bacillus amyloliquefaciens HM48

Experimental Data (6 measurements)

6 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent Benzene ?% 100 85 % 83 mM Tris-HCl buffer 8 70Β°C 0.54% (w/v) Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent Toluene ?% 100 86 % 83 mM Tris-HCl buffer 8 70Β°C 0.54% (w/v) Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent Xylene ?% 100 97 % 83 mM Tris-HCl buffer 8 70Β°C 0.54% (w/v) Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Stability - Incubation Activity after incubation (30 minutes at 35Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase Benzene ?% 100 71 % Incubation: ?, Assay: 83 mM Tris-HCl buffer Incubation: ?, Assay: 8 Incubation: 35Β°C, Assay: 70Β°C 0.54% (w/v) Casein free amino acids , Peptides β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (30 minutes at 35Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase Toluene ?% 100 80 % Incubation: ?, Assay: 83 mM Tris-HCl buffer Incubation: ?, Assay: 8 Incubation: 35Β°C, Assay: 70Β°C 0.54% (w/v) Casein free amino acids , Peptides β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (30 minutes at 35Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase Xylene ?% 100 87 % Incubation: ?, Assay: 83 mM Tris-HCl buffer Incubation: ?, Assay: 8 Incubation: 35Β°C, Assay: 70Β°C 0.54% (w/v) Casein free amino acids , Peptides β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*