Carboxylesterase (gene est56) from a compost metagenomic library

Enzyme Description

Species
Na (compost metagenomic library)
Extremophile
No but "halo-tolerant" enzyme
EC Number
3.1.1.1 β†—

Sequence

Length: 287 amino acids
MLAQSRAASTEPMDIAARRQAMEMFATPPAADVRVEPLTVAGVPAEWVVAPNADANVVLYLHGGGYVLGSCATHRDLAARVSRAAGARVLLLDYRLAPEHPFPAAVDDATAAYRWLLEQGSAPARIAIAGDSAGGGLAAATLLALRDADVPLPSSAVLISPWVDLAATGNSLKTRAHRDPMIVPDGLGELVRAYLGETDPKHPYASPLYDDLAGLPPLLVQVGTEEVLFDDGARFAARACEAGVPVTFEPWDEMIHVWHIFAPMLPEGQAAIDRLGAFIREHYPRQG
Mingji Lu et al. (2021) β€” A Novel Carboxylesterase Derived from a Compost Metagenome Exhibiting High Stability and Activity towards High Salinity
Genes  Β· doi:10.3390/genes12010122 β†—  Β· Stability - Incubation
20 measurements ▼
Database ID
UniParc: UPI000705CCAD β†—
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (20 measurements)

20 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (24 hours at 10Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Isopropanol 30% 100.0 286.6 % Incubation: ?, Assay: 50 mM sodium phosphate buffer Incubation: ?, Assay: 8 Incubation: 10Β°C, Assay: 50Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Yes, "constant shaking" incubation Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (24 hours at 10Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Toluene 30% 100.0 54.9 % Incubation: ?, Assay: 50 mM sodium phosphate buffer Incubation: ?, Assay: 8 Incubation: 10Β°C, Assay: 50Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Yes, "constant shaking" incubation Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (24 hours at 10Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Chloroform 30% 100.0 6.3 % Incubation: ?, Assay: 50 mM sodium phosphate buffer Incubation: ?, Assay: 8 Incubation: 10Β°C, Assay: 50Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Yes, "constant shaking" incubation Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (24 hours at 10Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Diethyl Ether 30% 100.0 106.7 % Incubation: ?, Assay: 50 mM sodium phosphate buffer Incubation: ?, Assay: 8 Incubation: 10Β°C, Assay: 50Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Yes, "constant shaking" incubation Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (24 hours at 10Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Ethyl Acetate 30% 100.0 50.2 % Incubation: ?, Assay: 50 mM sodium phosphate buffer Incubation: ?, Assay: 8 Incubation: 10Β°C, Assay: 50Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Yes, "constant shaking" incubation Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (24 hours at 10Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Toluene 15% 100.0 50.0 % Incubation: ?, Assay: 50 mM sodium phosphate buffer Incubation: ?, Assay: 8 Incubation: 10Β°C, Assay: 50Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Yes, "constant shaking" incubation Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (24 hours at 10Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Chloroform 15% 100.0 46.5 % Incubation: ?, Assay: 50 mM sodium phosphate buffer Incubation: ?, Assay: 8 Incubation: 10Β°C, Assay: 50Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Yes, "constant shaking" incubation Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (24 hours at 10Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Diethyl Ether 15% 100.0 110.8 % Incubation: ?, Assay: 50 mM sodium phosphate buffer Incubation: ?, Assay: 8 Incubation: 10Β°C, Assay: 50Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Yes, "constant shaking" incubation Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (24 hours at 10Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Ethyl Acetate 15% 100.0 55.3 % Incubation: ?, Assay: 50 mM sodium phosphate buffer Incubation: ?, Assay: 8 Incubation: 10Β°C, Assay: 50Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Yes, "constant shaking" incubation Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (24 hours at 10Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase 1-Propanol 30% 100.0 23.0 % Incubation: ?, Assay: 50 mM sodium phosphate buffer Incubation: ?, Assay: 8 Incubation: 10Β°C, Assay: 50Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Yes, "constant shaking" incubation Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (24 hours at 10Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 15% 100.0 135.0 % Incubation: ?, Assay: 50 mM sodium phosphate buffer Incubation: ?, Assay: 8 Incubation: 10Β°C, Assay: 50Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Yes, "constant shaking" incubation Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (24 hours at 10Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Acetone 30% 100.0 115.3 % Incubation: ?, Assay: 50 mM sodium phosphate buffer Incubation: ?, Assay: 8 Incubation: 10Β°C, Assay: 50Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Yes, "constant shaking" incubation Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (24 hours at 10Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Ethanol 30% 100.0 107.3 % Incubation: ?, Assay: 50 mM sodium phosphate buffer Incubation: ?, Assay: 8 Incubation: 10Β°C, Assay: 50Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Yes, "constant shaking" incubation Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (24 hours at 10Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Methanol 30% 100.0 96.6 % Incubation: ?, Assay: 50 mM sodium phosphate buffer Incubation: ?, Assay: 8 Incubation: 10Β°C, Assay: 50Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Yes, "constant shaking" incubation Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (24 hours at 10Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 30% 100.0 135.4 % Incubation: ?, Assay: 50 mM sodium phosphate buffer Incubation: ?, Assay: 8 Incubation: 10Β°C, Assay: 50Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Yes, "constant shaking" incubation Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (24 hours at 10Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase 1-Propanol 15% 100.0 114.0 % Incubation: ?, Assay: 50 mM sodium phosphate buffer Incubation: ?, Assay: 8 Incubation: 10Β°C, Assay: 50Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Yes, "constant shaking" incubation Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (24 hours at 10Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Isopropanol 15% 100.0 136.3 % Incubation: ?, Assay: 50 mM sodium phosphate buffer Incubation: ?, Assay: 8 Incubation: 10Β°C, Assay: 50Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Yes, "constant shaking" incubation Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (24 hours at 10Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Acetone 15% 100.0 138.3 % Incubation: ?, Assay: 50 mM sodium phosphate buffer Incubation: ?, Assay: 8 Incubation: 10Β°C, Assay: 50Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Yes, "constant shaking" incubation Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (24 hours at 10Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Ethanol 15% 100.0 116.2 % Incubation: ?, Assay: 50 mM sodium phosphate buffer Incubation: ?, Assay: 8 Incubation: 10Β°C, Assay: 50Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Yes, "constant shaking" incubation Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (24 hours at 10Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Methanol 15% 100.0 116.1 % Incubation: ?, Assay: 50 mM sodium phosphate buffer Incubation: ?, Assay: 8 Incubation: 10Β°C, Assay: 50Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Yes, "constant shaking" incubation Non-incubated control (in %), assay in aqueous phase

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*