Keratinase from Bacillus sp. CSK2

Enzyme Description

Extremophile
No but "thermostable" enzyme
EC Number

Sequence

Length: 157 amino acids
GCTLDEVAQGIGEVADSGAKVIRIRLGAPKGGIALPQAVRYAWNKGSVIVAAAGNVGNTKANYPAYNSEVIAVASTDQSDRKCSFSTYGSWVDVAAPGSNIYSTYKGSTYQSLSGTSMATPHVAGVAALLANQGYSNTQIRQIIESTTDKISGTGTY
Nonso E. Nnolim et al. (2020) β€” Bacillus sp. CSK2 produced thermostable alkaline keratinase using agro-wastes: keratinolytic enzyme characterization
BMC Biotechnology  Β· doi:10.1186/s12896-020-00659-2 β†—  Β· Stability - Incubation
3 measurements
Database ID
Sequence Annotation
Explicit - Provided
Protein Source
Purified, bacterium Bacillus sp. CSK2

Experimental Data (3 measurements)

3 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (1 hour at 37Β°C), measured by absorbance spectrophotometry (colorimetric assay, Azo-peptides absorbance measurement, 595 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 1% 100 114 % Incubation: ?, Assay: 50 mM Tris-HCl buffer Incubation: ?, Assay: 8 Incubation: 37Β°C, Assay: 60Β°C 5 g/l Keratin azure Azo-peptides , Peptides β€” Assay: 220 rpm Water-incubated control (in %), assay in aqueous conditions
Stability - Incubation Activity after incubation (1 hour at 37Β°C), measured by absorbance spectrophotometry (colorimetric assay, Azo-peptides absorbance measurement, 595 nm) in aqueous phase Acetonitrile 1% 100 61 % Incubation: ?, Assay: 50 mM Tris-HCl buffer Incubation: ?, Assay: 8 Incubation: 37Β°C, Assay: 60Β°C 5 g/l Keratin azure Azo-peptides , Peptides β€” Assay: 220 rpm Water-incubated control (in %), assay in aqueous conditions
Stability - Incubation Activity after incubation (1 hour at 37Β°C), measured by absorbance spectrophotometry (colorimetric assay, Azo-peptides absorbance measurement, 595 nm) in aqueous phase Isopropanol 1% 100 79 % Incubation: ?, Assay: 50 mM Tris-HCl buffer Incubation: ?, Assay: 8 Incubation: 37Β°C, Assay: 60Β°C 5 g/l Keratin azure Azo-peptides , Peptides β€” Assay: 220 rpm Water-incubated control (in %), assay in aqueous conditions

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*