Xylanase (gene xyn) from Bacillus subtilis RTS

Enzyme Description

Species

Extremophile

EC Number

3.2.1.8 ↗

Sequence

Length: 185 amino acids

ASPDYWQNWTDGGGTVNAVNGPGGNYSVNWSNTGNFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLALYGWTRAPLIEYYVVDSWGTYRPTGTYKGTVNSDGGTYDIYTTTRYNAPSIDGEKTTFTQYWSVRQTKRPHGSNAKITFSNHVRAWKSQGMNLGSIWSYQVLATEGYQSSGSSNVTVW

Aimen Saleem et al. (2021) — Biochemical characterization and molecular docking of cloned xylanase gene from Bacillus subtilis RTS expressed in E. coli

International Journal of Biological Macromolecules · doi:10.1016/j.ijbiomac.2020.12.001 ↗ · Stability - Incubation

15 measurements ▼

Database ID

—

Sequence Annotation

Explicit - Provided

Protein Source

Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (15 measurements)

15 measurements

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase	Acetone	10%	100.0	92.1	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 6.5	Incubation: Room temperature, Assay: 60°C	0.5% Soluble birchwood xylan	Reducing sugars	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase	Acetone	20%	100.0	77.9	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 6.5	Incubation: Room temperature, Assay: 60°C	0.5% Soluble birchwood xylan	Reducing sugars	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase	Acetone	30%	100.0	71.9	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 6.5	Incubation: Room temperature, Assay: 60°C	0.5% Soluble birchwood xylan	Reducing sugars	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase	Methanol	10%	100.0	70.0	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 6.5	Incubation: Room temperature, Assay: 60°C	0.5% Soluble birchwood xylan	Reducing sugars	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase	Methanol	20%	100.0	64.9	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 6.5	Incubation: Room temperature, Assay: 60°C	0.5% Soluble birchwood xylan	Reducing sugars	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase	Methanol	30%	100.0	50.0	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 6.5	Incubation: Room temperature, Assay: 60°C	0.5% Soluble birchwood xylan	Reducing sugars	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase	Ethanol	10%	100.0	98.1	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 6.5	Incubation: Room temperature, Assay: 60°C	0.5% Soluble birchwood xylan	Reducing sugars	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase	Ethanol	20%	100.0	92.1	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 6.5	Incubation: Room temperature, Assay: 60°C	0.5% Soluble birchwood xylan	Reducing sugars	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase	Ethanol	30%	100.0	88.1	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 6.5	Incubation: Room temperature, Assay: 60°C	0.5% Soluble birchwood xylan	Reducing sugars	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase	1-Propanol	10%	100.0	81.1	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 6.5	Incubation: Room temperature, Assay: 60°C	0.5% Soluble birchwood xylan	Reducing sugars	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase	1-Propanol	20%	100.0	78.1	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 6.5	Incubation: Room temperature, Assay: 60°C	0.5% Soluble birchwood xylan	Reducing sugars	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase	1-Propanol	30%	100.0	75.1	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 6.5	Incubation: Room temperature, Assay: 60°C	0.5% Soluble birchwood xylan	Reducing sugars	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase	1-Butanol	10%	100.0	95.1	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 6.5	Incubation: Room temperature, Assay: 60°C	0.5% Soluble birchwood xylan	Reducing sugars	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase	1-Butanol	20%	100.0	88.1	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 6.5	Incubation: Room temperature, Assay: 60°C	0.5% Soluble birchwood xylan	Reducing sugars	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase	1-Butanol	30%	100.0	85.1	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 6.5	Incubation: Room temperature, Assay: 60°C	0.5% Soluble birchwood xylan	Reducing sugars	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control

Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase	Acetone	10%	100.0	92.1	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 6.5	Incubation: Room temperature, Assay: 60°C	0.5% Soluble birchwood xylan	Reducing sugars	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase	Acetone	20%	100.0	77.9	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 6.5	Incubation: Room temperature, Assay: 60°C	0.5% Soluble birchwood xylan	Reducing sugars	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase	Acetone	30%	100.0	71.9	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 6.5	Incubation: Room temperature, Assay: 60°C	0.5% Soluble birchwood xylan	Reducing sugars	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase	Methanol	10%	100.0	70.0	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 6.5	Incubation: Room temperature, Assay: 60°C	0.5% Soluble birchwood xylan	Reducing sugars	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase	Methanol	20%	100.0	64.9	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 6.5	Incubation: Room temperature, Assay: 60°C	0.5% Soluble birchwood xylan	Reducing sugars	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase	Methanol	30%	100.0	50.0	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 6.5	Incubation: Room temperature, Assay: 60°C	0.5% Soluble birchwood xylan	Reducing sugars	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase	Ethanol	10%	100.0	98.1	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 6.5	Incubation: Room temperature, Assay: 60°C	0.5% Soluble birchwood xylan	Reducing sugars	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase	Ethanol	20%	100.0	92.1	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 6.5	Incubation: Room temperature, Assay: 60°C	0.5% Soluble birchwood xylan	Reducing sugars	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase	Ethanol	30%	100.0	88.1	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 6.5	Incubation: Room temperature, Assay: 60°C	0.5% Soluble birchwood xylan	Reducing sugars	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase	1-Propanol	10%	100.0	81.1	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 6.5	Incubation: Room temperature, Assay: 60°C	0.5% Soluble birchwood xylan	Reducing sugars	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase	1-Propanol	20%	100.0	78.1	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 6.5	Incubation: Room temperature, Assay: 60°C	0.5% Soluble birchwood xylan	Reducing sugars	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase	1-Propanol	30%	100.0	75.1	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 6.5	Incubation: Room temperature, Assay: 60°C	0.5% Soluble birchwood xylan	Reducing sugars	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase	1-Butanol	10%	100.0	95.1	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 6.5	Incubation: Room temperature, Assay: 60°C	0.5% Soluble birchwood xylan	Reducing sugars	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase	1-Butanol	20%	100.0	88.1	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 6.5	Incubation: Room temperature, Assay: 60°C	0.5% Soluble birchwood xylan	Reducing sugars	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase	1-Butanol	30%	100.0	85.1	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 6.5	Incubation: Room temperature, Assay: 60°C	0.5% Soluble birchwood xylan	Reducing sugars	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control

Visualization : Stability — Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate · Scroll to zoom · Right-click drag to pan · Powered by Mol*