Lipase (gene lipA) from Burkholderia cepacia G63

Enzyme Description

Species

Burkholderia cepacia G63 ↗

Extremophile

No but "thermostable" enzyme

EC Number

3.1.1.3 ↗

Sequence

Length: 363 amino acids

MAKSMRSRVMAGAVACAMSVAPFAGTTALTTLATTHAAMAATAPADDYATTRYPIILVHGLTGTDKYAGVLDYWYGIQEDLQQHGATVYVANLSGFQSDDGPNGRGEQLLAYVKTVLAATGATKVNLVGHSQGGLTSRYVAAVAPDLVASVTTIGTPHRGSEFADFVQDVLAYDPTELSSTVYAAFVNVFGILTSSSHNTNQDALASLKTLTTAQAATYNQNYPSAGLGAPGSCQTGAPTETVGGNTHLLYSWAGTAIQPTLSLFGVTGATDTSTVPVVDPANVLDPSTLALFGTGTVMINRGSGENDGLVSKCSALYGAVSTRYKWNHIDEINQLLGVRGAYAEDPVAVIRTHANRLKLAGV

Jun Zhang et al. (2020) — Co-Expression of a Thermally Stable and Methanol-Resistant Lipase and Its Chaperone from Burkholderia cepacia G63 in Escherichia coli

Applied Biochemistry and Biotechnology · doi:10.1007/s12010-020-03453-0 ↗ · Stability - Incubation

9 measurements ▼

Database ID

UniProt: Q4JL88 ↗

Sequence Annotation

Explicit - Provided GenBank Accession Number

Protein Source

Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (9 measurements)

9 measurements

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Stability - Incubation	Activity after incubation (1 hour at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Methanol	1%	100.0	108.1	%	Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer	Incubation: 8, Assay: 8	Incubation: 50°C, Assay: 50°C	? mM p-Nitrophenyl palmitate	p-Nitrophenol , Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about incubation buffer
Stability - Incubation	Activity after incubation (1 hour at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Ethanol	1%	100.0	83.18	%	Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer	Incubation: 8, Assay: 8	Incubation: 50°C, Assay: 50°C	? mM p-Nitrophenyl palmitate	p-Nitrophenol , Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about incubation buffer
Stability - Incubation	Activity after incubation (1 hour at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Isopropanol	1%	100.0	82.21	%	Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer	Incubation: 8, Assay: 8	Incubation: 50°C, Assay: 50°C	? mM p-Nitrophenyl palmitate	p-Nitrophenol , Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about incubation buffer
Stability - Incubation	Activity after incubation (1 hour at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	1-Butanol	1%	100.0	92.59	%	Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer	Incubation: 8, Assay: 8	Incubation: 50°C, Assay: 50°C	? mM p-Nitrophenyl palmitate	p-Nitrophenol , Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about incubation buffer
Stability - Incubation	Activity after incubation (1 hour at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Isoamyl Alcohol	1%	100.0	81.84	%	Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer	Incubation: 8, Assay: 8	Incubation: 50°C, Assay: 50°C	? mM p-Nitrophenyl palmitate	p-Nitrophenol , Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about incubation buffer
Stability - Incubation	Activity after incubation (1 hour at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Benzene	1%	100.0	87.6	%	Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer	Incubation: 8, Assay: 8	Incubation: 50°C, Assay: 50°C	? mM p-Nitrophenyl palmitate	p-Nitrophenol , Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about incubation buffer
Stability - Incubation	Activity after incubation (1 hour at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Toluene	1%	100.0	89.25	%	Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer	Incubation: 8, Assay: 8	Incubation: 50°C, Assay: 50°C	? mM p-Nitrophenyl palmitate	p-Nitrophenol , Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about incubation buffer
Stability - Incubation	Activity after incubation (1 hour at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	n-Hexane	1%	100.0	91.64	%	Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer	Incubation: 8, Assay: 8	Incubation: 50°C, Assay: 50°C	? mM p-Nitrophenyl palmitate	p-Nitrophenol , Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about incubation buffer
Stability - Incubation	Activity after incubation (1 hour at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Acetone	1%	100.0	70.76	%	Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer	Incubation: 8, Assay: 8	Incubation: 50°C, Assay: 50°C	? mM p-Nitrophenyl palmitate	p-Nitrophenol , Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about incubation buffer

Stability - Incubation	Activity after incubation (1 hour at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Methanol	1%	100.0	108.1	%	Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer	Incubation: 8, Assay: 8	Incubation: 50°C, Assay: 50°C	? mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about incubation buffer
Stability - Incubation	Activity after incubation (1 hour at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Ethanol	1%	100.0	83.18	%	Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer	Incubation: 8, Assay: 8	Incubation: 50°C, Assay: 50°C	? mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about incubation buffer
Stability - Incubation	Activity after incubation (1 hour at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Isopropanol	1%	100.0	82.21	%	Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer	Incubation: 8, Assay: 8	Incubation: 50°C, Assay: 50°C	? mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about incubation buffer
Stability - Incubation	Activity after incubation (1 hour at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	1-Butanol	1%	100.0	92.59	%	Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer	Incubation: 8, Assay: 8	Incubation: 50°C, Assay: 50°C	? mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about incubation buffer
Stability - Incubation	Activity after incubation (1 hour at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Isoamyl Alcohol	1%	100.0	81.84	%	Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer	Incubation: 8, Assay: 8	Incubation: 50°C, Assay: 50°C	? mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about incubation buffer
Stability - Incubation	Activity after incubation (1 hour at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Benzene	1%	100.0	87.6	%	Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer	Incubation: 8, Assay: 8	Incubation: 50°C, Assay: 50°C	? mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about incubation buffer
Stability - Incubation	Activity after incubation (1 hour at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Toluene	1%	100.0	89.25	%	Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer	Incubation: 8, Assay: 8	Incubation: 50°C, Assay: 50°C	? mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about incubation buffer
Stability - Incubation	Activity after incubation (1 hour at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	n-Hexane	1%	100.0	91.64	%	Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer	Incubation: 8, Assay: 8	Incubation: 50°C, Assay: 50°C	? mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about incubation buffer
Stability - Incubation	Activity after incubation (1 hour at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Acetone	1%	100.0	70.76	%	Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer	Incubation: 8, Assay: 8	Incubation: 50°C, Assay: 50°C	? mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about incubation buffer

Visualization : Stability — Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate · Scroll to zoom · Right-click drag to pan · Powered by Mol*