Cysteine endopeptidase EP-B 2-like from Zea mays
Enzyme Description
Sequence
MAQVAKTLLLVALVVVSAVELCRAIEFDERDLASDEALWDLYERWQTHHRVHRHHGEKGRRFGTFKENARFIHAHNKRGDRPYRLRLNRFGDMGREEFRSGFADSRINDLRREPTAAPAVPGFMYDDATDLPRSVDWRQKGAVTAVKNQGRCGSCWAFSTVVAVEGINAIRTGSLVSLSEQELIDCDTDENGCQGGLMENAFEFIKSHGGITTESAYPYHASNGTCDGARARRGRVVAIDGHQAVPAGSEDALAKAVAHQPVSVAIDAGGQALQFYSEGVFTGDCGTDLDHGVAAVGYGVSDDGTPYWIVKNSWGPSWGEGGYIRMQRGTGNGGLCGIAMEASFPIKTSPNPSRKPRRALITRDASSQ
Wenjing Zhang et al. (2020)
β Characterization of a recombinant zein-degrading protease from Zea mays by Pichia pastoris and its effects on enzymatic hydrolysis of corn starch
International Journal of Biological Macromolecules
Β· doi:10.1016/j.ijbiomac.2020.08.237 β
Β· Activity - Classical
▼
Database ID
NCBI: NP_001130571.2 β
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host yeast Pichia pastoris X33
Experimental Data (8 measurements)
8 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 340 nm) in the presence of organic solvent | Ethanol | 15% | 100 | 17 | % | 100 mM citrate -Na2HPO4 buffer | 5 | 40Β°C | 2.5 mg/ml Azocasein | Azo-peptides , Peptides | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 340 nm) in the presence of organic solvent | Ethanol | 30% | 100 | 5 | % | 100 mM citrate -Na2HPO4 buffer | 5 | 40Β°C | 2.5 mg/ml Azocasein | Azo-peptides , Peptides | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 340 nm) in the presence of organic solvent | Methanol | 15% | 100 | 46 | % | 100 mM citrate -Na2HPO4 buffer | 5 | 40Β°C | 2.5 mg/ml Azocasein | Azo-peptides , Peptides | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 340 nm) in the presence of organic solvent | Methanol | 30% | 100 | 16 | % | 100 mM citrate -Na2HPO4 buffer | 5 | 40Β°C | 2.5 mg/ml Azocasein | Azo-peptides , Peptides | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 340 nm) in the presence of organic solvent | Acetone | 15% | 100 | 33 | % | 100 mM citrate -Na2HPO4 buffer | 5 | 40Β°C | 2.5 mg/ml Azocasein | Azo-peptides , Peptides | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 340 nm) in the presence of organic solvent | Acetone | 30% | 100 | 23 | % | 100 mM citrate -Na2HPO4 buffer | 5 | 40Β°C | 2.5 mg/ml Azocasein | Azo-peptides , Peptides | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 340 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 15% | 100 | 13 | % | 100 mM citrate -Na2HPO4 buffer | 5 | 40Β°C | 2.5 mg/ml Azocasein | Azo-peptides , Peptides | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 340 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 30% | 100 | 10 | % | 100 mM citrate -Na2HPO4 buffer | 5 | 40Β°C | 2.5 mg/ml Azocasein | Azo-peptides , Peptides | β | β | Classical aqueous control (in %) |
Visualization : Activity β Classical
One bar per measurement. Colour = solvent, shade = solvent volume.