Esterase (gene XtjR8) from a lotus pond sludge metagenomic library

Enzyme Description

Species
Na (lotus pond sludge metagenomic library)
Extremophile
No
EC Number
3.1.1.1 β†—

Sequence

Length: 314 amino acids
MMPSWQARLFSIISRLTIKRRSDRQVADEIEGAKLVRKLFEPPDFLRPKLPAGVSVQPVTDRGVHGEWVECDNPLRTIYYLHGGGYVACSPKTHRGFTSQLSLAAQARILSLDYRLAPENKFPAAVEDAVGGYRLLLDKGARPERIIIGGDSAGGGLAVATLIAIGERGLPLPAAAFLLSPWTDLAATGDSIVTNDPTDPMLSGKMTHKLAALYYGEASPTDPLVSPLYGDLRGLPPLLIYVSDTEILLDDSRRLAERARQQGVAVDLQIWSGLPHVWPIFVAYGIPESKIVLGEIAEFVKQQTSMLQKTETAA
Jiarong Qiu et al. (2020) β€” Characterization of XtjR8: A novel esterase with phthalate-hydrolyzing activity from a metagenomic library of lotus pond sludge
International Journal of Biological Macromolecules  Β· doi:10.1016/j.ijbiomac.2020.07.317 β†—  Β· Activity - Classical
10 measurements ▼
Database ID
UniProt: A0A5P8EA36 β†—
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (10 measurements)

10 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by HPLC (monoester formation measurement after 10 minutes incubation at 40Β°C) in the presence of organic solvent Methanol 25% 100 96 % 100 mM Tris–HCl buffer 8 40Β°C 0.5 mM Dibutyl phthalate 1-Butanol , Mono-n-butyl phthalate β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (monoester formation measurement after 10 minutes incubation at 40Β°C) in the presence of organic solvent Methanol 50% 100 33 % 100 mM Tris–HCl buffer 8 40Β°C 0.5 mM Dibutyl phthalate 1-Butanol , Mono-n-butyl phthalate β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (monoester formation measurement after 10 minutes incubation at 40Β°C) in the presence of organic solvent Ethanol 25% 100 89 % 100 mM Tris–HCl buffer 8 40Β°C 0.5 mM Dibutyl phthalate 1-Butanol , Mono-n-butyl phthalate β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (monoester formation measurement after 10 minutes incubation at 40Β°C) in the presence of organic solvent Ethanol 50% 100 57 % 100 mM Tris–HCl buffer 8 40Β°C 0.5 mM Dibutyl phthalate 1-Butanol , Mono-n-butyl phthalate β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (monoester formation measurement after 10 minutes incubation at 40Β°C) in the presence of organic solvent Isopropanol 25% 100 75 % 100 mM Tris–HCl buffer 8 40Β°C 0.5 mM Dibutyl phthalate 1-Butanol , Mono-n-butyl phthalate β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (monoester formation measurement after 10 minutes incubation at 40Β°C) in the presence of organic solvent Isopropanol 50% 100 25 % 100 mM Tris–HCl buffer 8 40Β°C 0.5 mM Dibutyl phthalate 1-Butanol , Mono-n-butyl phthalate β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (monoester formation measurement after 10 minutes incubation at 40Β°C) in the presence of organic solvent Acetone 25% 100 71 % 100 mM Tris–HCl buffer 8 40Β°C 0.5 mM Dibutyl phthalate 1-Butanol , Mono-n-butyl phthalate β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (monoester formation measurement after 10 minutes incubation at 40Β°C) in the presence of organic solvent Acetone 50% 100 37 % 100 mM Tris–HCl buffer 8 40Β°C 0.5 mM Dibutyl phthalate 1-Butanol , Mono-n-butyl phthalate β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (monoester formation measurement after 10 minutes incubation at 40Β°C) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 25% 100 83 % 100 mM Tris–HCl buffer 8 40Β°C 0.5 mM Dibutyl phthalate 1-Butanol , Mono-n-butyl phthalate β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (monoester formation measurement after 10 minutes incubation at 40Β°C) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 50% 100 46 % 100 mM Tris–HCl buffer 8 40Β°C 0.5 mM Dibutyl phthalate 1-Butanol , Mono-n-butyl phthalate β€” β€” Classical aqueous control (in %)

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*