Esterase (gene BlEstA) from Bacillus licheniformis

Enzyme Description

Species
Bacillus licheniformis β†—
Extremophile
No but "halotolerant" enzyme
EC Number
3.1.1.1 β†—

Sequence

Length: 212 amino acids
MTLQYTALGDSLTVGVGAGLFEPGFVQRYKRKMEEDLNEEVSLIVFAKSGLETSEILAMLNEPFIMEQVKKADVITITGCGNDLLQSLEIYEKEKDEHVFLEASSHCQKNYSGMLEKIREIKGEKDTRYLVRLLNLYNPFPSIELADKWISGFNRHLKQLESAPQIKVIDTYAVFKGREKEYLSIDRVHPSSRGYEAMSEKLRAAGYGRLEG
Ana Elisa T. Leite et al. (2020) β€” Low-resolution molecular shape, biochemical characterization and emulsification properties of a halotolerant esterase from Bacillus licheniformis
European Biophysics Journal  Β· doi:10.1007/s00249-020-01448-7 β†—  Β· Activity - Classical
15 measurements ▼
Database ID
UniParc: UPI000043D0A6 β†—
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli Rosetta

Experimental Data (15 measurements)

15 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Ethanol 10% 100 119 % 50 mM ABF buffer 9 30Β°C 0.02 mM p-Nitrophenyl caprylate Caprylic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Ethanol 20% 100 274 % 50 mM ABF buffer 9 30Β°C 0.02 mM p-Nitrophenyl caprylate Caprylic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Ethanol 30% 100 159 % 50 mM ABF buffer 9 30Β°C 0.02 mM p-Nitrophenyl caprylate Caprylic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Ethanol 40% 100 155 % 50 mM ABF buffer 9 30Β°C 0.02 mM p-Nitrophenyl caprylate Caprylic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Ethanol 50% 100 67 % 50 mM ABF buffer 9 30Β°C 0.02 mM p-Nitrophenyl caprylate Caprylic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Methanol 10% 100 112 % 50 mM ABF buffer 9 30Β°C 0.02 mM p-Nitrophenyl caprylate Caprylic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Methanol 20% 100 171 % 50 mM ABF buffer 9 30Β°C 0.02 mM p-Nitrophenyl caprylate Caprylic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Methanol 30% 100 257 % 50 mM ABF buffer 9 30Β°C 0.02 mM p-Nitrophenyl caprylate Caprylic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Methanol 40% 100 193 % 50 mM ABF buffer 9 30Β°C 0.02 mM p-Nitrophenyl caprylate Caprylic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Methanol 50% 100 71 % 50 mM ABF buffer 9 30Β°C 0.02 mM p-Nitrophenyl caprylate Caprylic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 10% 100 120 % 50 mM ABF buffer 9 30Β°C 0.02 mM p-Nitrophenyl caprylate Caprylic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 20% 100 130 % 50 mM ABF buffer 9 30Β°C 0.02 mM p-Nitrophenyl caprylate Caprylic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 30% 100 146 % 50 mM ABF buffer 9 30Β°C 0.02 mM p-Nitrophenyl caprylate Caprylic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 40% 100 204 % 50 mM ABF buffer 9 30Β°C 0.02 mM p-Nitrophenyl caprylate Caprylic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 50% 100 211 % 50 mM ABF buffer 9 30Β°C 0.02 mM p-Nitrophenyl caprylate Caprylic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*