Protease 1147 from Cohnella sp. A01
Enzyme Description
Sequence
MKKVAFLLANDFEDSEMQKPYEAIRAAGHETVIIGLKKGEKLTGKNKQATYTTDASIDEAKADQFDAVVIPGGSSPENLRLNKQIQQFVKDMDSQGKPIAAICHGPQILISAGLAKGKTLTCYPPLQDDLINAGANYVDQEVVVDGHYITSRTPADEPAFIRETLNKLS
Hossein Tarrahimofrad et al. (2020)
β Structural and biochemical characterization of a novel thermophilic Coh01147 protease
PLOS ONE
Β· doi:10.1371/journal.pone.0234958 β
Β· Activity - Classical
▼
Database ID
UniProt: A0A5J6KIY6 β
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (18 measurements)
18 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent | Glycerol | 2% | 100.0 | 117.8 | % | 50 mM glycine-NaOH buffer | 10.5 | 60Β°C | 1% Casein | free amino acids , Peptides | β | β | Classical aqueous control (in %) | Uncertainty about assay conditions (buffer, pH and temperature) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 3% | 100.0 | 86.6 | % | 50 mM glycine-NaOH buffer | 10.5 | 60Β°C | 1% Casein | free amino acids , Peptides | β | β | Classical aqueous control (in %) | Uncertainty about assay conditions (buffer, pH and temperature) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent | Acetone | 3% | 100.0 | 90.6 | % | 50 mM glycine-NaOH buffer | 10.5 | 60Β°C | 1% Casein | free amino acids , Peptides | β | β | Classical aqueous control (in %) | Uncertainty about assay conditions (buffer, pH and temperature) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent | Glycerol | 3% | 100.0 | 94.4 | % | 50 mM glycine-NaOH buffer | 10.5 | 60Β°C | 1% Casein | free amino acids , Peptides | β | β | Classical aqueous control (in %) | Uncertainty about assay conditions (buffer, pH and temperature) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent | Isopropanol | 3% | 100.0 | 86.6 | % | 50 mM glycine-NaOH buffer | 10.5 | 60Β°C | 1% Casein | free amino acids , Peptides | β | β | Classical aqueous control (in %) | Uncertainty about assay conditions (buffer, pH and temperature) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent | Ethanol | 3% | 100.0 | 86.9 | % | 50 mM glycine-NaOH buffer | 10.5 | 60Β°C | 1% Casein | free amino acids , Peptides | β | β | Classical aqueous control (in %) | Uncertainty about assay conditions (buffer, pH and temperature) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent | Methanol | 3% | 100.0 | 83.9 | % | 50 mM glycine-NaOH buffer | 10.5 | 60Β°C | 1% Casein | free amino acids , Peptides | β | β | Classical aqueous control (in %) | Uncertainty about assay conditions (buffer, pH and temperature) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 2% | 100.0 | 122.1 | % | 50 mM glycine-NaOH buffer | 10.5 | 60Β°C | 1% Casein | free amino acids , Peptides | β | β | Classical aqueous control (in %) | Uncertainty about assay conditions (buffer, pH and temperature) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent | Acetone | 2% | 100.0 | 93.9 | % | 50 mM glycine-NaOH buffer | 10.5 | 60Β°C | 1% Casein | free amino acids , Peptides | β | β | Classical aqueous control (in %) | Uncertainty about assay conditions (buffer, pH and temperature) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent | Methanol | 1% | 100.0 | 120.0 | % | 50 mM glycine-NaOH buffer | 10.5 | 60Β°C | 1% Casein | free amino acids , Peptides | β | β | Classical aqueous control (in %) | Uncertainty about assay conditions (buffer, pH and temperature) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent | Isopropanol | 2% | 100.0 | 93.6 | % | 50 mM glycine-NaOH buffer | 10.5 | 60Β°C | 1% Casein | free amino acids , Peptides | β | β | Classical aqueous control (in %) | Uncertainty about assay conditions (buffer, pH and temperature) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent | Ethanol | 2% | 100.0 | 98.4 | % | 50 mM glycine-NaOH buffer | 10.5 | 60Β°C | 1% Casein | free amino acids , Peptides | β | β | Classical aqueous control (in %) | Uncertainty about assay conditions (buffer, pH and temperature) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent | Methanol | 2% | 100.0 | 113.6 | % | 50 mM glycine-NaOH buffer | 10.5 | 60Β°C | 1% Casein | free amino acids , Peptides | β | β | Classical aqueous control (in %) | Uncertainty about assay conditions (buffer, pH and temperature) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 1% | 100.0 | 116.9 | % | 50 mM glycine-NaOH buffer | 10.5 | 60Β°C | 1% Casein | free amino acids , Peptides | β | β | Classical aqueous control (in %) | Uncertainty about assay conditions (buffer, pH and temperature) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent | Acetone | 1% | 100.0 | 92.1 | % | 50 mM glycine-NaOH buffer | 10.5 | 60Β°C | 1% Casein | free amino acids , Peptides | β | β | Classical aqueous control (in %) | Uncertainty about assay conditions (buffer, pH and temperature) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent | Glycerol | 1% | 100.0 | 126.9 | % | 50 mM glycine-NaOH buffer | 10.5 | 60Β°C | 1% Casein | free amino acids , Peptides | β | β | Classical aqueous control (in %) | Uncertainty about assay conditions (buffer, pH and temperature) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent | Isopropanol | 1% | 100.0 | 94.8 | % | 50 mM glycine-NaOH buffer | 10.5 | 60Β°C | 1% Casein | free amino acids , Peptides | β | β | Classical aqueous control (in %) | Uncertainty about assay conditions (buffer, pH and temperature) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent | Ethanol | 1% | 100.0 | 99.1 | % | 50 mM glycine-NaOH buffer | 10.5 | 60Β°C | 1% Casein | free amino acids , Peptides | β | β | Classical aqueous control (in %) | Uncertainty about assay conditions (buffer, pH and temperature) |
Visualization : Activity β Classical
One bar per measurement. Colour = solvent, shade = solvent volume.