Protease 1147 from Cohnella sp. A01

Enzyme Description

Extremophile
Yes "thermophilic" organism
EC Number

Sequence

Length: 169 amino acids
MKKVAFLLANDFEDSEMQKPYEAIRAAGHETVIIGLKKGEKLTGKNKQATYTTDASIDEAKADQFDAVVIPGGSSPENLRLNKQIQQFVKDMDSQGKPIAAICHGPQILISAGLAKGKTLTCYPPLQDDLINAGANYVDQEVVVDGHYITSRTPADEPAFIRETLNKLS
Hossein Tarrahimofrad et al. (2020) β€” Structural and biochemical characterization of a novel thermophilic Coh01147 protease
PLOS ONE  Β· doi:10.1371/journal.pone.0234958 β†—  Β· Activity - Classical
18 measurements
Database ID
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (18 measurements)

18 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent Glycerol 2% 100.0 117.8 % 50 mM glycine-NaOH buffer 10.5 60Β°C 1% Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %) | Uncertainty about assay conditions (buffer, pH and temperature)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 3% 100.0 86.6 % 50 mM glycine-NaOH buffer 10.5 60Β°C 1% Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %) | Uncertainty about assay conditions (buffer, pH and temperature)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent Acetone 3% 100.0 90.6 % 50 mM glycine-NaOH buffer 10.5 60Β°C 1% Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %) | Uncertainty about assay conditions (buffer, pH and temperature)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent Glycerol 3% 100.0 94.4 % 50 mM glycine-NaOH buffer 10.5 60Β°C 1% Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %) | Uncertainty about assay conditions (buffer, pH and temperature)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent Isopropanol 3% 100.0 86.6 % 50 mM glycine-NaOH buffer 10.5 60Β°C 1% Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %) | Uncertainty about assay conditions (buffer, pH and temperature)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent Ethanol 3% 100.0 86.9 % 50 mM glycine-NaOH buffer 10.5 60Β°C 1% Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %) | Uncertainty about assay conditions (buffer, pH and temperature)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent Methanol 3% 100.0 83.9 % 50 mM glycine-NaOH buffer 10.5 60Β°C 1% Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %) | Uncertainty about assay conditions (buffer, pH and temperature)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 2% 100.0 122.1 % 50 mM glycine-NaOH buffer 10.5 60Β°C 1% Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %) | Uncertainty about assay conditions (buffer, pH and temperature)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent Acetone 2% 100.0 93.9 % 50 mM glycine-NaOH buffer 10.5 60Β°C 1% Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %) | Uncertainty about assay conditions (buffer, pH and temperature)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent Methanol 1% 100.0 120.0 % 50 mM glycine-NaOH buffer 10.5 60Β°C 1% Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %) | Uncertainty about assay conditions (buffer, pH and temperature)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent Isopropanol 2% 100.0 93.6 % 50 mM glycine-NaOH buffer 10.5 60Β°C 1% Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %) | Uncertainty about assay conditions (buffer, pH and temperature)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent Ethanol 2% 100.0 98.4 % 50 mM glycine-NaOH buffer 10.5 60Β°C 1% Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %) | Uncertainty about assay conditions (buffer, pH and temperature)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent Methanol 2% 100.0 113.6 % 50 mM glycine-NaOH buffer 10.5 60Β°C 1% Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %) | Uncertainty about assay conditions (buffer, pH and temperature)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 1% 100.0 116.9 % 50 mM glycine-NaOH buffer 10.5 60Β°C 1% Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %) | Uncertainty about assay conditions (buffer, pH and temperature)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent Acetone 1% 100.0 92.1 % 50 mM glycine-NaOH buffer 10.5 60Β°C 1% Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %) | Uncertainty about assay conditions (buffer, pH and temperature)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent Glycerol 1% 100.0 126.9 % 50 mM glycine-NaOH buffer 10.5 60Β°C 1% Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %) | Uncertainty about assay conditions (buffer, pH and temperature)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent Isopropanol 1% 100.0 94.8 % 50 mM glycine-NaOH buffer 10.5 60Β°C 1% Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %) | Uncertainty about assay conditions (buffer, pH and temperature)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent Ethanol 1% 100.0 99.1 % 50 mM glycine-NaOH buffer 10.5 60Β°C 1% Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %) | Uncertainty about assay conditions (buffer, pH and temperature)

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*