Esterase from Lactobacillus fermentum LF-12

Enzyme Description

Species
Lactobacillus fermentum LF-12 β†—
Extremophile
No
EC Number
3.1.1.- β†—

Sequence

Length: 284 amino acids
MKKVINVAVERDGLWLDSDIVYAQVPGWLGNATRNLRLSVIRHFATGDDTKFPVIFWFAGGGWMDTDHNIHLPNLVDFARAGYLVVGVEYRDSNKVNFPGQLEDAKAAIRYMRANAAKFQADPDRFVVMGESAGGHLASMLGLTNGMTEFDVGDHLDVSSDVQVAVPWYGVVDPLTAKQGSATDAFDFVYRNLLGAEPEDAPELDAKANPLTYVSKKSVPFLILHGQQDQVVPVKDSEVLYEALNQAGVDADLYELETAGHMDVQFMQPAVFKLILEFLKKHLN
Yujin Liu et al. (2020) β€” Purification, characterization and molecular cloning of a dicaffeoylquinic acid-hydrolyzing esterase from human-derived Lactobacillus fermentum LF-12
Food & Function  Β· doi:10.1039/d0fo00029a β†—  Β· Activity - Classical
20 measurements ▼
Database ID
UniProt: A0A1D7ZZE6 β†—
Sequence Annotation
Explicit - Provided (first residue from UniProt sequence replaced by 7 first explicit residues from article)
Protein Source
Recombinant, host bacterium Escherichia coli Arctic-Expressβ„’

Experimental Data (20 measurements)

20 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by HPLC (caffeic acid formation after 15 minutes incubatio at 45Β°C) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 15% 100 63 % Citric acid–sodium citrate buffer ? 45Β°C ? mM 3,5- and 4,5-DiCQA, ? mM Mixture of 3,4- Caffeic acid β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (caffeic acid formation after 15 minutes incubatio at 45Β°C) in the presence of organic solvent Ethanol 20% 100 55 % Citric acid–sodium citrate buffer ? 45Β°C ? mM 3,5- and 4,5-DiCQA, ? mM Mixture of 3,4- Caffeic acid β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (caffeic acid formation after 15 minutes incubatio at 45Β°C) in the presence of organic solvent Ethanol 15% 100 58 % Citric acid–sodium citrate buffer ? 45Β°C ? mM 3,5- and 4,5-DiCQA, ? mM Mixture of 3,4- Caffeic acid β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (caffeic acid formation after 15 minutes incubatio at 45Β°C) in the presence of organic solvent Ethanol 10% 100 66 % Citric acid–sodium citrate buffer ? 45Β°C ? mM 3,5- and 4,5-DiCQA, ? mM Mixture of 3,4- Caffeic acid β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (caffeic acid formation after 15 minutes incubatio at 45Β°C) in the presence of organic solvent Ethanol 5% 100 79 % Citric acid–sodium citrate buffer ? 45Β°C ? mM 3,5- and 4,5-DiCQA, ? mM Mixture of 3,4- Caffeic acid β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (caffeic acid formation after 15 minutes incubatio at 45Β°C) in the presence of organic solvent Acetone 20% 100 36 % Citric acid–sodium citrate buffer ? 45Β°C ? mM 3,5- and 4,5-DiCQA, ? mM Mixture of 3,4- Caffeic acid β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (caffeic acid formation after 15 minutes incubatio at 45Β°C) in the presence of organic solvent Acetone 15% 100 50 % Citric acid–sodium citrate buffer ? 45Β°C ? mM 3,5- and 4,5-DiCQA, ? mM Mixture of 3,4- Caffeic acid β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (caffeic acid formation after 15 minutes incubatio at 45Β°C) in the presence of organic solvent Acetone 10% 100 59 % Citric acid–sodium citrate buffer ? 45Β°C ? mM 3,5- and 4,5-DiCQA, ? mM Mixture of 3,4- Caffeic acid β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (caffeic acid formation after 15 minutes incubatio at 45Β°C) in the presence of organic solvent Acetone 5% 100 66 % Citric acid–sodium citrate buffer ? 45Β°C ? mM 3,5- and 4,5-DiCQA, ? mM Mixture of 3,4- Caffeic acid β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (caffeic acid formation after 15 minutes incubatio at 45Β°C) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 20% 100 57 % Citric acid–sodium citrate buffer ? 45Β°C ? mM 3,5- and 4,5-DiCQA, ? mM Mixture of 3,4- Caffeic acid β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (caffeic acid formation after 15 minutes incubatio at 45Β°C) in the presence of organic solvent Methanol 5% 100 85 % Citric acid–sodium citrate buffer ? 45Β°C ? mM 3,5- and 4,5-DiCQA, ? mM Mixture of 3,4- Caffeic acid β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (caffeic acid formation after 15 minutes incubatio at 45Β°C) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 10% 100 77 % Citric acid–sodium citrate buffer ? 45Β°C ? mM 3,5- and 4,5-DiCQA, ? mM Mixture of 3,4- Caffeic acid β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (caffeic acid formation after 15 minutes incubatio at 45Β°C) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 5% 100 88 % Citric acid–sodium citrate buffer ? 45Β°C ? mM 3,5- and 4,5-DiCQA, ? mM Mixture of 3,4- Caffeic acid β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (caffeic acid formation after 15 minutes incubatio at 45Β°C) in the presence of organic solvent Acetonitrile 20% 100 42 % Citric acid–sodium citrate buffer ? 45Β°C ? mM 3,5- and 4,5-DiCQA, ? mM Mixture of 3,4- Caffeic acid β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (caffeic acid formation after 15 minutes incubatio at 45Β°C) in the presence of organic solvent Acetonitrile 15% 100 52 % Citric acid–sodium citrate buffer ? 45Β°C ? mM 3,5- and 4,5-DiCQA, ? mM Mixture of 3,4- Caffeic acid β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (caffeic acid formation after 15 minutes incubatio at 45Β°C) in the presence of organic solvent Acetonitrile 10% 100 73 % Citric acid–sodium citrate buffer ? 45Β°C ? mM 3,5- and 4,5-DiCQA, ? mM Mixture of 3,4- Caffeic acid β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (caffeic acid formation after 15 minutes incubatio at 45Β°C) in the presence of organic solvent Acetonitrile 5% 100 90 % Citric acid–sodium citrate buffer ? 45Β°C ? mM 3,5- and 4,5-DiCQA, ? mM Mixture of 3,4- Caffeic acid β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (caffeic acid formation after 15 minutes incubatio at 45Β°C) in the presence of organic solvent Methanol 20% 100 54 % Citric acid–sodium citrate buffer ? 45Β°C ? mM 3,5- and 4,5-DiCQA, ? mM Mixture of 3,4- Caffeic acid β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (caffeic acid formation after 15 minutes incubatio at 45Β°C) in the presence of organic solvent Methanol 15% 100 78 % Citric acid–sodium citrate buffer ? 45Β°C ? mM 3,5- and 4,5-DiCQA, ? mM Mixture of 3,4- Caffeic acid β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (caffeic acid formation after 15 minutes incubatio at 45Β°C) in the presence of organic solvent Methanol 10% 100 80 % Citric acid–sodium citrate buffer ? 45Β°C ? mM 3,5- and 4,5-DiCQA, ? mM Mixture of 3,4- Caffeic acid β€” β€” Classical aqueous control (in %)

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*