Laccase (gene mco) from Staphylococcus haemolyticus

Enzyme Description

Species
Staphylococcus haemolyticus β†—
Extremophile
No
EC Number
1.10.3.2 β†—

Sequence

Length: 477 amino acids
MYNKVFTILIIIFSIIIIASNDTFAESKNDMMNMKEDKKNTMDMTNMKHHDERKKLNSSQGKNEIIFPEVAESKKDNNGYKNYTLKAQKGKTEFYKNNFSNTLGYNGNLLGPTLKLKKGDKVKIKLINNLDENTTFHWHGLEVNGKVDGGPSQVIKPGKEKTIKFEVNQDSATLWYHPHPSPNTAKQVYNGLSGLLYIEDSKKNNYPSNYGKNDLPIIIQDKTFVSKKLNYSKTKDEDGTQGDTVLVNGIVNPKLTAKEEKIRLRLLNGSNARDLNLKLSNNQSFEYIASDGGQLKNAKKLKEINLAPSERKEIVIDLSKMKGEKVSLVDNDKTVILPISNKEKSSNKSNTPKVSKKIKLEGMNDNVTINGNKFDPNRIDFTQKLNQKEVWEIENVKDKMGGMKHPFHIHGTQFKVLSVDGEKPPKDMRGKKDVISLEPGQKAKIEVVFKNTGTYMFHCHILEHEDNGMMGQIKVTN
Xingxing Li et al. (2020) β€” Multiple Tolerance and Dye Decolorization Ability of a Novel Laccase Identified from Staphylococcus Haemolyticus
Journal of Microbiology and Biotechnology  Β· doi:10.4014/jmb.1910.10061 β†—  Β· Stability - Incubation
8 measurements ▼
Database ID
UniProt: L7SV51 β†—
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21

Experimental Data (8 measurements)

8 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (15 minutes at 30Β°C), measured by absorbance spectrophotometry (ABTS absorbance measurement, 420 nm) in aqueous phase Ethanol 30% 100 21 % Incubation: 100 mM sodium acetate buffer, Assay: 100 mM sodium acetate buffer Incubation: 4.5, Assay: 4.5 Incubation: 30Β°C, Assay: 30Β°C 1 mM ABTS ABTS radical cation β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (15 minutes at 30Β°C), measured by absorbance spectrophotometry (ABTS absorbance measurement, 420 nm) in aqueous phase Ethanol 10% 100 54 % Incubation: 100 mM sodium acetate buffer, Assay: 100 mM sodium acetate buffer Incubation: 4.5, Assay: 4.5 Incubation: 30Β°C, Assay: 30Β°C 1 mM ABTS ABTS radical cation β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (15 minutes at 30Β°C), measured by absorbance spectrophotometry (ABTS absorbance measurement, 420 nm) in aqueous phase Methanol 30% 100 37 % Incubation: 100 mM sodium acetate buffer, Assay: 100 mM sodium acetate buffer Incubation: 4.5, Assay: 4.5 Incubation: 30Β°C, Assay: 30Β°C 1 mM ABTS ABTS radical cation β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (15 minutes at 30Β°C), measured by absorbance spectrophotometry (ABTS absorbance measurement, 420 nm) in aqueous phase Methanol 10% 100 76 % Incubation: 100 mM sodium acetate buffer, Assay: 100 mM sodium acetate buffer Incubation: 4.5, Assay: 4.5 Incubation: 30Β°C, Assay: 30Β°C 1 mM ABTS ABTS radical cation β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (15 minutes at 30Β°C), measured by absorbance spectrophotometry (ABTS absorbance measurement, 420 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 30% 100 19 % Incubation: 100 mM sodium acetate buffer, Assay: 100 mM sodium acetate buffer Incubation: 4.5, Assay: 4.5 Incubation: 30Β°C, Assay: 30Β°C 1 mM ABTS ABTS radical cation β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (15 minutes at 30Β°C), measured by absorbance spectrophotometry (ABTS absorbance measurement, 420 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 10% 100 70 % Incubation: 100 mM sodium acetate buffer, Assay: 100 mM sodium acetate buffer Incubation: 4.5, Assay: 4.5 Incubation: 30Β°C, Assay: 30Β°C 1 mM ABTS ABTS radical cation β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (15 minutes at 30Β°C), measured by absorbance spectrophotometry (ABTS absorbance measurement, 420 nm) in aqueous phase Acetone 30% 100 11 % Incubation: 100 mM sodium acetate buffer, Assay: 100 mM sodium acetate buffer Incubation: 4.5, Assay: 4.5 Incubation: 30Β°C, Assay: 30Β°C 1 mM ABTS ABTS radical cation β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (15 minutes at 30Β°C), measured by absorbance spectrophotometry (ABTS absorbance measurement, 420 nm) in aqueous phase Acetone 10% 100 27 % Incubation: 100 mM sodium acetate buffer, Assay: 100 mM sodium acetate buffer Incubation: 4.5, Assay: 4.5 Incubation: 30Β°C, Assay: 30Β°C 1 mM ABTS ABTS radical cation β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*