Aldo-keto reductase (gene AKR3B4) from Rhodotorula mucilaginosa LSL

Enzyme Description

Species
Rhodotorula mucilaginosa LSL β†—
Extremophile
No
EC Number
1.1.1.- β†—

Sequence

Length: 324 amino acids
MSQQIPSVKLSNGAEFPLLGFGTWQSAPGEVGKAVEVALKAGYRHLDLAKVYGNQKEIAPAIANSGVDRKDIFITSKLWNSQHKPELVEAALDDTLKELGLEYLDLYLIHWPVAFPAEGDPHSNLFPKENGECKIDTSISIVDTWKAMIKLLDTGKTKAVGVSNFSPAMVDAITEATGVKPVVNQIERHPRLLQKDLLKHHKEKNIVVTAYSGFGNNSVGEPLLLEHPTVKKIAEAKGANPGQVLIAWGMHGGHAIIPKSVTPSRIESNFKVISLTDDEVAEINKIGEEKPARFNLPIDYTPKWNINVFDTPQEKDAKYQVKIQ
Abi L. Anello et al. (2020) β€” Broadening the repertoire of microbial aldo-keto reductases: cloning and characterization of AKR3B4 from Rhodotorula mucilaginosa LSL strain
Enzyme and Microbial Technology  Β· doi:10.1016/j.enzmictec.2019.109415 β†—  Β· Activity - Classical Stability - Incubation
14 measurements ▼
Database ID
UniProt: A0A1Y0DT75 β†—
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 pLysS

Experimental Data (14 measurements)

14 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent Acetone 10% 0.65 0.92 1/s 50 mM phosphate buffer 8 25Β°C 5 mM p-Nitrobenzaldehyde p-Nitrobenzyl alcohol 5 mM NADPH β€” Classical aqueous control (in 1/s) | Authors describe organism as extremophile, but it does not appear justified
Activity - Classical Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent Ethanol 10% 0.65 1.53 1/s 50 mM phosphate buffer 8 25Β°C 5 mM p-Nitrobenzaldehyde p-Nitrobenzyl alcohol 5 mM NADPH β€” Classical aqueous control (in 1/s) | Authors describe organism as extremophile, but it does not appear justified
Activity - Classical Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent 1-Propanol 10% 0.65 1.53 1/s 50 mM phosphate buffer 8 25Β°C 5 mM p-Nitrobenzaldehyde p-Nitrobenzyl alcohol 5 mM NADPH β€” Classical aqueous control (in 1/s) | Authors describe organism as extremophile, but it does not appear justified
Activity - Classical Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent Ethyl Acetate 10% 0.65 1.4 1/s 50 mM phosphate buffer 8 25Β°C 5 mM p-Nitrobenzaldehyde p-Nitrobenzyl alcohol 5 mM NADPH β€” Classical aqueous control (in 1/s) | Authors describe organism as extremophile, but it does not appear justified
Activity - Classical Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent Tetrahydrofuran (THF) 10% 0.65 0.45 1/s 50 mM phosphate buffer 8 25Β°C 5 mM p-Nitrobenzaldehyde p-Nitrobenzyl alcohol 5 mM NADPH β€” Classical aqueous control (in 1/s) | Authors describe organism as extremophile, but it does not appear justified
Activity - Classical Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent Acetonitrile 10% 0.65 1.05 1/s 50 mM phosphate buffer 8 25Β°C 5 mM p-Nitrobenzaldehyde p-Nitrobenzyl alcohol 5 mM NADPH β€” Classical aqueous control (in 1/s) | Authors describe organism as extremophile, but it does not appear justified
Activity - Classical Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 10% 0.65 1.28 1/s 50 mM phosphate buffer 8 25Β°C 5 mM p-Nitrobenzaldehyde p-Nitrobenzyl alcohol 5 mM NADPH β€” Classical aqueous control (in 1/s) | Authors describe organism as extremophile, but it does not appear justified
Stability - Incubation Activity after incubation (5 hours at 25Β°C), measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm), in aqueous phase Acetone 10% 1.59 0.89 1/s Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: 25Β°C 5 mM p-Nitrobenzaldehyde p-Nitrobenzyl alcohol 5 mM NADPH β€” Water-incubated control (in 1/s), assay in aqueous phase | Uncertainty about incubation buffer / Authors describe organism as extremophile, but it does not appear justified
Stability - Incubation Activity after incubation (5 hours at 25Β°C), measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm), in aqueous phase Ethanol 10% 1.59 0.67 1/s Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: 25Β°C 5 mM p-Nitrobenzaldehyde p-Nitrobenzyl alcohol 5 mM NADPH β€” Water-incubated control (in 1/s), assay in aqueous phase | Uncertainty about incubation buffer / Authors describe organism as extremophile, but it does not appear justified
Stability - Incubation Activity after incubation (5 hours at 25Β°C), measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm), in aqueous phase 1-Propanol 10% 1.59 1.34 1/s Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: 25Β°C 5 mM p-Nitrobenzaldehyde p-Nitrobenzyl alcohol 5 mM NADPH β€” Water-incubated control (in 1/s), assay in aqueous phase | Uncertainty about incubation buffer / Authors describe organism as extremophile, but it does not appear justified
Stability - Incubation Activity after incubation (5 hours at 25Β°C), measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm), in aqueous phase Ethyl Acetate 10% 1.59 0.42 1/s Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: 25Β°C 5 mM p-Nitrobenzaldehyde p-Nitrobenzyl alcohol 5 mM NADPH β€” Water-incubated control (in 1/s), assay in aqueous phase | Uncertainty about incubation buffer / Authors describe organism as extremophile, but it does not appear justified
Stability - Incubation Activity after incubation (5 hours at 25Β°C), measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm), in aqueous phase Tetrahydrofuran (THF) 10% 1.59 0.42 1/s Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: 25Β°C 5 mM p-Nitrobenzaldehyde p-Nitrobenzyl alcohol 5 mM NADPH β€” Water-incubated control (in 1/s), assay in aqueous phase | Uncertainty about incubation buffer / Authors describe organism as extremophile, but it does not appear justified
Stability - Incubation Activity after incubation (5 hours at 25Β°C), measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm), in aqueous phase Acetonitrile 10% 1.59 1.21 1/s Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: 25Β°C 5 mM p-Nitrobenzaldehyde p-Nitrobenzyl alcohol 5 mM NADPH β€” Water-incubated control (in 1/s), assay in aqueous phase | Uncertainty about incubation buffer / Authors describe organism as extremophile, but it does not appear justified
Stability - Incubation Activity after incubation (5 hours at 25Β°C), measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm), in aqueous phase Dimethyl Sulfoxide (DMSO) 10% 1.59 0.92 1/s Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: 25Β°C 5 mM p-Nitrobenzaldehyde p-Nitrobenzyl alcohol 5 mM NADPH β€” Water-incubated control (in 1/s), assay in aqueous phase | Uncertainty about incubation buffer / Authors describe organism as extremophile, but it does not appear justified

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*