Esterase (gene est906) from a paper mill wastewater sediment metagenomic library

Enzyme Description

Species
Na (paper mill wastewater sediment metagenomic library)
Extremophile
No
EC Number
3.1.1.1 β†—

Sequence

Length: 301 amino acids
MKKSVLVFAFLVSLFTGSVMAQSKRVAASAGRSEYIEVEKNVRLHVTDLGEGQPIVLIHGWPLSDAMYEYQYQYLSRKGFRVIGITLRGFGQSDKPYGKYDFDVFSDDIKVVLEKLNIQNAVLGGFSMGGAVVIHYVTKYNAAHISKLALFGAAAPSWKQRDGSPYGISDADAEGLIKATMTSRQDLIAGFGAAFPAKEGAISKNVEKWLENINLQAWPYASTESITALRDLDLRPSLSKIKIPTVIFHGTQDKLCPFVFAEQLQKGINNSYIVKFENSGHALFVEEADKFNTELEKFAKQ
Xiao-Lin Zhong et al. (2020) β€” Characterization and purification via nucleic acid aptamers of a novel esterase from the metagenome of paper mill wastewater sediments
International Journal of Biological Macromolecules  Β· doi:10.1016/j.ijbiomac.2020.02.319 β†—  Β· Stability - Incubation
15 measurements ▼
Database ID
UniParc: UPI00118AC712 β†—
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (15 measurements)

15 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (20 minutes at 54Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Acetonitrile 1% 100.0 98.1 % Incubation: 40 mM Britton-Robinson buffer, Assay: 40 mM Britton-Robinson buffer Incubation: 9.5, Assay: 7.8 Incubation: 54Β°C, Assay: 45Β°C 50 mM p-Nitrophenyl hexanoate caproic acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (20 minutes at 54Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Acetonitrile 15% 100.0 93.6 % Incubation: 40 mM Britton-Robinson buffer, Assay: 40 mM Britton-Robinson buffer Incubation: 9.5, Assay: 7.8 Incubation: 54Β°C, Assay: 45Β°C 50 mM p-Nitrophenyl hexanoate caproic acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (20 minutes at 54Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Acetonitrile 30% 100.0 39.0 % Incubation: 40 mM Britton-Robinson buffer, Assay: 40 mM Britton-Robinson buffer Incubation: 9.5, Assay: 7.8 Incubation: 54Β°C, Assay: 45Β°C 50 mM p-Nitrophenyl hexanoate caproic acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (20 minutes at 54Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Methanol 1% 100.0 122.2 % Incubation: 40 mM Britton-Robinson buffer, Assay: 40 mM Britton-Robinson buffer Incubation: 9.5, Assay: 7.8 Incubation: 54Β°C, Assay: 45Β°C 50 mM p-Nitrophenyl hexanoate caproic acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (20 minutes at 54Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Methanol 15% 100.0 156.9 % Incubation: 40 mM Britton-Robinson buffer, Assay: 40 mM Britton-Robinson buffer Incubation: 9.5, Assay: 7.8 Incubation: 54Β°C, Assay: 45Β°C 50 mM p-Nitrophenyl hexanoate caproic acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (20 minutes at 54Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Methanol 30% 100.0 134.7 % Incubation: 40 mM Britton-Robinson buffer, Assay: 40 mM Britton-Robinson buffer Incubation: 9.5, Assay: 7.8 Incubation: 54Β°C, Assay: 45Β°C 50 mM p-Nitrophenyl hexanoate caproic acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (20 minutes at 54Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Ethanol 1% 100.0 117.4 % Incubation: 40 mM Britton-Robinson buffer, Assay: 40 mM Britton-Robinson buffer Incubation: 9.5, Assay: 7.8 Incubation: 54Β°C, Assay: 45Β°C 50 mM p-Nitrophenyl hexanoate caproic acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (20 minutes at 54Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Ethanol 15% 100.0 128.4 % Incubation: 40 mM Britton-Robinson buffer, Assay: 40 mM Britton-Robinson buffer Incubation: 9.5, Assay: 7.8 Incubation: 54Β°C, Assay: 45Β°C 50 mM p-Nitrophenyl hexanoate caproic acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (20 minutes at 54Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Ethanol 30% 100.0 100.2 % Incubation: 40 mM Britton-Robinson buffer, Assay: 40 mM Britton-Robinson buffer Incubation: 9.5, Assay: 7.8 Incubation: 54Β°C, Assay: 45Β°C 50 mM p-Nitrophenyl hexanoate caproic acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (20 minutes at 54Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Isopropanol 1% 100.0 119.8 % Incubation: 40 mM Britton-Robinson buffer, Assay: 40 mM Britton-Robinson buffer Incubation: 9.5, Assay: 7.8 Incubation: 54Β°C, Assay: 45Β°C 50 mM p-Nitrophenyl hexanoate caproic acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (20 minutes at 54Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Isopropanol 15% 100.0 120.8 % Incubation: 40 mM Britton-Robinson buffer, Assay: 40 mM Britton-Robinson buffer Incubation: 9.5, Assay: 7.8 Incubation: 54Β°C, Assay: 45Β°C 50 mM p-Nitrophenyl hexanoate caproic acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (20 minutes at 54Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Isopropanol 30% 100.0 74.9 % Incubation: 40 mM Britton-Robinson buffer, Assay: 40 mM Britton-Robinson buffer Incubation: 9.5, Assay: 7.8 Incubation: 54Β°C, Assay: 45Β°C 50 mM p-Nitrophenyl hexanoate caproic acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (20 minutes at 54Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 1% 100.0 89.3 % Incubation: 40 mM Britton-Robinson buffer, Assay: 40 mM Britton-Robinson buffer Incubation: 9.5, Assay: 7.8 Incubation: 54Β°C, Assay: 45Β°C 50 mM p-Nitrophenyl hexanoate caproic acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (20 minutes at 54Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 15% 100.0 98.0 % Incubation: 40 mM Britton-Robinson buffer, Assay: 40 mM Britton-Robinson buffer Incubation: 9.5, Assay: 7.8 Incubation: 54Β°C, Assay: 45Β°C 50 mM p-Nitrophenyl hexanoate caproic acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (20 minutes at 54Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 30% 100.0 51.4 % Incubation: 40 mM Britton-Robinson buffer, Assay: 40 mM Britton-Robinson buffer Incubation: 9.5, Assay: 7.8 Incubation: 54Β°C, Assay: 45Β°C 50 mM p-Nitrophenyl hexanoate caproic acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*