Serine protease 2 (gene baapr2) from Bacillus altitudinis W3

Enzyme Description

Species

Bacillus altitudinis W3 ↗

Extremophile

No but "alkaline-stable" enzyme

EC Number

3.4.21.62 ↗

Sequence

Length: 376 amino acids

MKVKSFGAGLCMASMLLASMTFGASDVSAKDQAKKEYMIGFSSSVQDKTQKQLVEKAGGHVKESIEKIDMMKVSLNEASKEKLHQAKEVTFIEEDQKAKTSGQSVPYGIKSIKAQKVHKRGYAGQNVKVAVLDSGIDGKHEDLHVTGGVSFVPTESDPLVDPHEHGTHVAGTIAALDNKVGVVGVAPKASIYAVKVADENGDGYYSWIIKGIEWAIENEMDVINISMGGASESEALKEAVDRAYDNGILIVASAGNAGSYGSLNTIDYPAKYSSVMAVASVDQRKQRAFDSSVGEEVEVSAPGVSTLSTIPHNEYGYKSGTSMASPHVAGAAAVILSKHPNLTNDELRERLTKTATKLGEPFYYGAGLVNVQKAAR

Shaolan Yang et al. (2020) — Mining of alkaline proteases from Bacillus altitudinis W3 for desensitization of milk proteins: Their heterologous expression, purification, and characterization

International Journal of Biological Macromolecules · doi:10.1016/j.ijbiomac.2019.10.252 ↗ · Stability - Incubation

9 measurements ▼

Database ID

UniProt: A0A6G6A873 ↗

Sequence Annotation

Explicit - Provided

Protein Source

Recombinant, host bacterium Bacillus subtilis WB600

Experimental Data (9 measurements)

9 measurements

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Stability - Incubation	Activity after incubation (1 hour at 25°C), measured by absorbance spectrophotometry (colorimetric assay, change in Azo-peptides absorbance measurement, 440 nm) in aqueous phase	Dimethyl Sulfoxide (DMSO)	0.5%	100	98	%	Incubation: 50 mM glycine-NaOH buffer, Assay: 50 mM glycine-NaOH buffer, 2 mM CaCl2	Incubation: 8.5, Assay: 10	Incubation: 25°C, Assay: 50°C	2 g/L Azocasein	Azo-peptides , Peptides	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 hour at 25°C), measured by absorbance spectrophotometry (colorimetric assay, change in Azo-peptides absorbance measurement, 440 nm) in aqueous phase	Methanol	5%	100	98	%	Incubation: 50 mM glycine-NaOH buffer, Assay: 50 mM glycine-NaOH buffer, 2 mM CaCl2	Incubation: 8.5, Assay: 10	Incubation: 25°C, Assay: 50°C	2 g/L Azocasein	Azo-peptides , Peptides	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 hour at 25°C), measured by absorbance spectrophotometry (colorimetric assay, change in Azo-peptides absorbance measurement, 440 nm) in aqueous phase	Ethanol	5%	100	81	%	Incubation: 50 mM glycine-NaOH buffer, Assay: 50 mM glycine-NaOH buffer, 2 mM CaCl2	Incubation: 8.5, Assay: 10	Incubation: 25°C, Assay: 50°C	2 g/L Azocasein	Azo-peptides , Peptides	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 hour at 25°C), measured by absorbance spectrophotometry (colorimetric assay, change in Azo-peptides absorbance measurement, 440 nm) in aqueous phase	Isopropanol	5%	100	74	%	Incubation: 50 mM glycine-NaOH buffer, Assay: 50 mM glycine-NaOH buffer, 2 mM CaCl2	Incubation: 8.5, Assay: 10	Incubation: 25°C, Assay: 50°C	2 g/L Azocasein	Azo-peptides , Peptides	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 hour at 25°C), measured by absorbance spectrophotometry (colorimetric assay, change in Azo-peptides absorbance measurement, 440 nm) in aqueous phase	Acetone	5%	100	93	%	Incubation: 50 mM glycine-NaOH buffer, Assay: 50 mM glycine-NaOH buffer, 2 mM CaCl2	Incubation: 8.5, Assay: 10	Incubation: 25°C, Assay: 50°C	2 g/L Azocasein	Azo-peptides , Peptides	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 hour at 25°C), measured by absorbance spectrophotometry (colorimetric assay, change in Azo-peptides absorbance measurement, 440 nm) in aqueous phase	Acetonitrile	5%	100	73	%	Incubation: 50 mM glycine-NaOH buffer, Assay: 50 mM glycine-NaOH buffer, 2 mM CaCl2	Incubation: 8.5, Assay: 10	Incubation: 25°C, Assay: 50°C	2 g/L Azocasein	Azo-peptides , Peptides	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 hour at 25°C), measured by absorbance spectrophotometry (colorimetric assay, change in Azo-peptides absorbance measurement, 440 nm) in aqueous phase	Dichloromethane	5%	100	35	%	Incubation: 50 mM glycine-NaOH buffer, Assay: 50 mM glycine-NaOH buffer, 2 mM CaCl2	Incubation: 8.5, Assay: 10	Incubation: 25°C, Assay: 50°C	2 g/L Azocasein	Azo-peptides , Peptides	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 hour at 25°C), measured by absorbance spectrophotometry (colorimetric assay, change in Azo-peptides absorbance measurement, 440 nm) in aqueous phase	n-Hexane	5%	100	103	%	Incubation: 50 mM glycine-NaOH buffer, Assay: 50 mM glycine-NaOH buffer, 2 mM CaCl2	Incubation: 8.5, Assay: 10	Incubation: 25°C, Assay: 50°C	2 g/L Azocasein	Azo-peptides , Peptides	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 hour at 25°C), measured by absorbance spectrophotometry (colorimetric assay, change in Azo-peptides absorbance measurement, 440 nm) in aqueous phase	Ethyl Acetate	5%	100	66	%	Incubation: 50 mM glycine-NaOH buffer, Assay: 50 mM glycine-NaOH buffer, 2 mM CaCl2	Incubation: 8.5, Assay: 10	Incubation: 25°C, Assay: 50°C	2 g/L Azocasein	Azo-peptides , Peptides	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent

Stability - Incubation	Activity after incubation (1 hour at 25°C), measured by absorbance spectrophotometry (colorimetric assay, change in Azo-peptides absorbance measurement, 440 nm) in aqueous phase	Dimethyl Sulfoxide (DMSO)	0.5%	100	98	%	Incubation: 50 mM glycine-NaOH buffer, Assay: 50 mM glycine-NaOH buffer, 2 mM CaCl2	Incubation: 8.5, Assay: 10	Incubation: 25°C, Assay: 50°C	2 g/L Azocasein	Azo-peptides, Peptides	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 hour at 25°C), measured by absorbance spectrophotometry (colorimetric assay, change in Azo-peptides absorbance measurement, 440 nm) in aqueous phase	Methanol	5%	100	98	%	Incubation: 50 mM glycine-NaOH buffer, Assay: 50 mM glycine-NaOH buffer, 2 mM CaCl2	Incubation: 8.5, Assay: 10	Incubation: 25°C, Assay: 50°C	2 g/L Azocasein	Azo-peptides, Peptides	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 hour at 25°C), measured by absorbance spectrophotometry (colorimetric assay, change in Azo-peptides absorbance measurement, 440 nm) in aqueous phase	Ethanol	5%	100	81	%	Incubation: 50 mM glycine-NaOH buffer, Assay: 50 mM glycine-NaOH buffer, 2 mM CaCl2	Incubation: 8.5, Assay: 10	Incubation: 25°C, Assay: 50°C	2 g/L Azocasein	Azo-peptides, Peptides	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 hour at 25°C), measured by absorbance spectrophotometry (colorimetric assay, change in Azo-peptides absorbance measurement, 440 nm) in aqueous phase	Isopropanol	5%	100	74	%	Incubation: 50 mM glycine-NaOH buffer, Assay: 50 mM glycine-NaOH buffer, 2 mM CaCl2	Incubation: 8.5, Assay: 10	Incubation: 25°C, Assay: 50°C	2 g/L Azocasein	Azo-peptides, Peptides	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 hour at 25°C), measured by absorbance spectrophotometry (colorimetric assay, change in Azo-peptides absorbance measurement, 440 nm) in aqueous phase	Acetone	5%	100	93	%	Incubation: 50 mM glycine-NaOH buffer, Assay: 50 mM glycine-NaOH buffer, 2 mM CaCl2	Incubation: 8.5, Assay: 10	Incubation: 25°C, Assay: 50°C	2 g/L Azocasein	Azo-peptides, Peptides	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 hour at 25°C), measured by absorbance spectrophotometry (colorimetric assay, change in Azo-peptides absorbance measurement, 440 nm) in aqueous phase	Acetonitrile	5%	100	73	%	Incubation: 50 mM glycine-NaOH buffer, Assay: 50 mM glycine-NaOH buffer, 2 mM CaCl2	Incubation: 8.5, Assay: 10	Incubation: 25°C, Assay: 50°C	2 g/L Azocasein	Azo-peptides, Peptides	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 hour at 25°C), measured by absorbance spectrophotometry (colorimetric assay, change in Azo-peptides absorbance measurement, 440 nm) in aqueous phase	Dichloromethane	5%	100	35	%	Incubation: 50 mM glycine-NaOH buffer, Assay: 50 mM glycine-NaOH buffer, 2 mM CaCl2	Incubation: 8.5, Assay: 10	Incubation: 25°C, Assay: 50°C	2 g/L Azocasein	Azo-peptides, Peptides	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 hour at 25°C), measured by absorbance spectrophotometry (colorimetric assay, change in Azo-peptides absorbance measurement, 440 nm) in aqueous phase	n-Hexane	5%	100	103	%	Incubation: 50 mM glycine-NaOH buffer, Assay: 50 mM glycine-NaOH buffer, 2 mM CaCl2	Incubation: 8.5, Assay: 10	Incubation: 25°C, Assay: 50°C	2 g/L Azocasein	Azo-peptides, Peptides	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 hour at 25°C), measured by absorbance spectrophotometry (colorimetric assay, change in Azo-peptides absorbance measurement, 440 nm) in aqueous phase	Ethyl Acetate	5%	100	66	%	Incubation: 50 mM glycine-NaOH buffer, Assay: 50 mM glycine-NaOH buffer, 2 mM CaCl2	Incubation: 8.5, Assay: 10	Incubation: 25°C, Assay: 50°C	2 g/L Azocasein	Azo-peptides, Peptides	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent

Visualization : Stability — Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate · Scroll to zoom · Right-click drag to pan · Powered by Mol*