Laccase from Rigidoporus lignosus
Enzyme Description
Sequence
MPSFASLKSLVVLSLTSLSLAATVALDLHILNANLDPDGTGARSAVTAEGTTIAPLITGNIDDRFQINVIDQLTDANMRRATSIHWHGFFQAGTTEMDGPAFVNQCPIIPNESFVYDFVVPGQAGTYWYHSHLSTQYCDGLRGAFVVYDPNDPHLSLYDVDDASTVITIADWYHSLSTVLFPNPNKAPPAPDTTLINGLGRNSANPSAGQLAVVSVQSGKRYRFRIVSTSCFPNYAFSIDGHRMTVIEVDGVSHQPLTVDSLTIFAGQRYSVVVEANQAVGNYWIRANPSNGRNGFTGGINSAIFRYEGAAVAEPTTSQNSGTALNEANLIPLINPGAPGNPVPGGADINLNLRIGRNATTADFTINGAPFIPPTVPVLLQILSGVTNPNDLLPGGAVISLPANQVIEISIPGGGNHPFHLHGHNFDVVRTPGSSVYNYVNPVRRDVVSIGGGGDNVTFRFVTDNPGPWFLHCHIDWHLEAGLAVVFAEDIPNIPIANAISPAWDDLCPKYNANNPDSGLA
MariaTeresa Cambria et al. (2000)
β Production, Purification, and Properties of an Extracellular Laccase from Rigidoporus lignosus
Protein Expression and Purification
Β· doi:10.1006/prep.1999.1126 β
Β· Stability - Incubation
▼
Database ID
UniProt: Q6H9H7 β
Sequence Annotation
Inferred - from protein name
Protein Source
Purified, fungus Rigidoporus lignosus
Experimental Data (5 measurements)
5 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in the presence of organic solvent | Acetone | 50% | 100.0 | 86.0 | % | Incubation: 0.1 MM Na-Citrate buffer, Assay: 0.1 MM Na-Citrate buffer | Incubation: 3, Assay: 3 | Incubation: 25Β°C, Assay: 25Β°C | 4 mM ABTS | ABTS radical cation | β | β | Non-incubated control in the presence of organic solvent (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 50% | 100.0 | 97.0 | % | Incubation: 0.1 MM Na-Citrate buffer, Assay: 0.1 MM Na-Citrate buffer | Incubation: 3, Assay: 3 | Incubation: 25Β°C, Assay: 25Β°C | 4 mM ABTS | ABTS radical cation | β | β | Non-incubated control in the presence of organic solvent (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in the presence of organic solvent | Methanol | 50% | 100.0 | 30.0 | % | Incubation: 0.1 MM Na-Citrate buffer, Assay: 0.1 MM Na-Citrate buffer | Incubation: 3, Assay: 3 | Incubation: 25Β°C, Assay: 25Β°C | 4 mM ABTS | ABTS radical cation | β | β | Non-incubated control in the presence of organic solvent (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in the presence of organic solvent | Acetonitrile | 50% | 100.0 | 5.6 | % | Incubation: 0.1 MM Na-Citrate buffer, Assay: 0.1 MM Na-Citrate buffer | Incubation: 3, Assay: 3 | Incubation: 25Β°C, Assay: 25Β°C | 4 mM ABTS | ABTS radical cation | β | β | Non-incubated control in the presence of organic solvent (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in the presence of organic solvent | 1,4-Dioxane | 50% | 100.0 | 3.2 | % | Incubation: 0.1 MM Na-Citrate buffer, Assay: 0.1 MM Na-Citrate buffer | Incubation: 3, Assay: 3 | Incubation: 25Β°C, Assay: 25Β°C | 4 mM ABTS | ABTS radical cation | β | β | Non-incubated control in the presence of organic solvent (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.