Laccase from Rigidoporus lignosus

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 521 amino acids
MPSFASLKSLVVLSLTSLSLAATVALDLHILNANLDPDGTGARSAVTAEGTTIAPLITGNIDDRFQINVIDQLTDANMRRATSIHWHGFFQAGTTEMDGPAFVNQCPIIPNESFVYDFVVPGQAGTYWYHSHLSTQYCDGLRGAFVVYDPNDPHLSLYDVDDASTVITIADWYHSLSTVLFPNPNKAPPAPDTTLINGLGRNSANPSAGQLAVVSVQSGKRYRFRIVSTSCFPNYAFSIDGHRMTVIEVDGVSHQPLTVDSLTIFAGQRYSVVVEANQAVGNYWIRANPSNGRNGFTGGINSAIFRYEGAAVAEPTTSQNSGTALNEANLIPLINPGAPGNPVPGGADINLNLRIGRNATTADFTINGAPFIPPTVPVLLQILSGVTNPNDLLPGGAVISLPANQVIEISIPGGGNHPFHLHGHNFDVVRTPGSSVYNYVNPVRRDVVSIGGGGDNVTFRFVTDNPGPWFLHCHIDWHLEAGLAVVFAEDIPNIPIANAISPAWDDLCPKYNANNPDSGLA
MariaTeresa Cambria et al. (2000) β€” Production, Purification, and Properties of an Extracellular Laccase from Rigidoporus lignosus
Protein Expression and Purification  Β· doi:10.1006/prep.1999.1126 β†—  Β· Stability - Incubation
5 measurements
Database ID
UniProt: Q6H9H7 β†—
Sequence Annotation
Inferred - from protein name
Protein Source
Purified, fungus Rigidoporus lignosus

Experimental Data (5 measurements)

5 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in the presence of organic solvent Acetone 50% 100.0 86.0 % Incubation: 0.1 MM Na-Citrate buffer, Assay: 0.1 MM Na-Citrate buffer Incubation: 3, Assay: 3 Incubation: 25Β°C, Assay: 25Β°C 4 mM ABTS ABTS radical cation β€” β€” Non-incubated control in the presence of organic solvent (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 50% 100.0 97.0 % Incubation: 0.1 MM Na-Citrate buffer, Assay: 0.1 MM Na-Citrate buffer Incubation: 3, Assay: 3 Incubation: 25Β°C, Assay: 25Β°C 4 mM ABTS ABTS radical cation β€” β€” Non-incubated control in the presence of organic solvent (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in the presence of organic solvent Methanol 50% 100.0 30.0 % Incubation: 0.1 MM Na-Citrate buffer, Assay: 0.1 MM Na-Citrate buffer Incubation: 3, Assay: 3 Incubation: 25Β°C, Assay: 25Β°C 4 mM ABTS ABTS radical cation β€” β€” Non-incubated control in the presence of organic solvent (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in the presence of organic solvent Acetonitrile 50% 100.0 5.6 % Incubation: 0.1 MM Na-Citrate buffer, Assay: 0.1 MM Na-Citrate buffer Incubation: 3, Assay: 3 Incubation: 25Β°C, Assay: 25Β°C 4 mM ABTS ABTS radical cation β€” β€” Non-incubated control in the presence of organic solvent (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 420 nm) in the presence of organic solvent 1,4-Dioxane 50% 100.0 3.2 % Incubation: 0.1 MM Na-Citrate buffer, Assay: 0.1 MM Na-Citrate buffer Incubation: 3, Assay: 3 Incubation: 25Β°C, Assay: 25Β°C 4 mM ABTS ABTS radical cation β€” β€” Non-incubated control in the presence of organic solvent (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*