Carboxylesterase (gene BaCEs04) from Bacillus velezensis SYBC H47

Enzyme Description

Species

Bacillus velezensis SYBC H47 ↗

Extremophile

No but thermophilic enzyme

EC Number

3.1.1.1 ↗

Sequence

Length: 289 amino acids

MDGKQINRGFAPAGRYAVPGTEVREMRSKGGRTFRIFVSFPQEEPPASGFPVIYLLDANSVFGTMAEALRVQSRRPEKTGVVPAVIVGIGYPTDQPFSAERHSDFTMPLSESELPVHPRGAAWPEQGGAEAFLEFIEEEVKPAMERDYPIDRGRQTIFGHSLGGLFVLQVLLTRPDMFQTYVAGSPSIHWNKRFIQENAERLSDRLSAENLQVSVLLAAGEIEKTHKSRIPQHAEALYALLSGFEGDGVRAEYSEFEGEGHISVLPVLISRALRFCLNPGGPHTPYSPA

Lin Huang et al. (2020) — Characterization of a novel carboxylesterase from Bacillus velezensis SYBC H47 and its application in degradation of phthalate esters

Journal of Bioscience and Bioengineering · doi:10.1016/j.jbiosc.2019.11.002 ↗ · Stability - Incubation

6 measurements ▼

Database ID

UniProt: A0A5C1ZXA0 ↗

Sequence Annotation

Explicit - Provided

Protein Source

Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (6 measurements)

6 measurements

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Stability - Incubation	Activity after incubation (1 hour at 37°C), measured by absorbance spectrophotometry (β-naphtol absorbance measurement, 555 nm) in aqueous phase	Ethanol	10%	100.0	93.64	%	Incubation: 50 mM potassium phosphate, Assay: 50 mM potassium phosphate	Incubation: 7, Assay: 7	Incubation: 37°C, Assay: 37°C	600 mM 2-Naphthyl acetate	Acetate , beta-naphtol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about assay buffer and pH
Stability - Incubation	Activity after incubation (1 hour at 37°C), measured by absorbance spectrophotometry (β-naphtol absorbance measurement, 555 nm) in aqueous phase	Methanol	10%	100.0	85.81	%	Incubation: 50 mM potassium phosphate, Assay: 50 mM potassium phosphate	Incubation: 7, Assay: 7	Incubation: 37°C, Assay: 37°C	600 mM 2-Naphthyl acetate	Acetate , beta-naphtol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about assay buffer and pH
Stability - Incubation	Activity after incubation (1 hour at 37°C), measured by absorbance spectrophotometry (β-naphtol absorbance measurement, 555 nm) in aqueous phase	Isopropanol	10%	100.0	126.9	%	Incubation: 50 mM potassium phosphate, Assay: 50 mM potassium phosphate	Incubation: 7, Assay: 7	Incubation: 37°C, Assay: 37°C	600 mM 2-Naphthyl acetate	Acetate , beta-naphtol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about assay buffer and pH
Stability - Incubation	Activity after incubation (1 hour at 37°C), measured by absorbance spectrophotometry (β-naphtol absorbance measurement, 555 nm) in aqueous phase	Acetone	10%	100.0	122.32	%	Incubation: 50 mM potassium phosphate, Assay: 50 mM potassium phosphate	Incubation: 7, Assay: 7	Incubation: 37°C, Assay: 37°C	600 mM 2-Naphthyl acetate	Acetate , beta-naphtol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about assay buffer and pH
Stability - Incubation	Activity after incubation (1 hour at 37°C), measured by absorbance spectrophotometry (β-naphtol absorbance measurement, 555 nm) in aqueous phase	n-Hexane	10%	100.0	130.23	%	Incubation: 50 mM potassium phosphate, Assay: 50 mM potassium phosphate	Incubation: 7, Assay: 7	Incubation: 37°C, Assay: 37°C	600 mM 2-Naphthyl acetate	Acetate , beta-naphtol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about assay buffer and pH
Stability - Incubation	Activity after incubation (1 hour at 37°C), measured by absorbance spectrophotometry (β-naphtol absorbance measurement, 555 nm) in aqueous phase	Acetonitrile	10%	100.0	82.85	%	Incubation: 50 mM potassium phosphate, Assay: 50 mM potassium phosphate	Incubation: 7, Assay: 7	Incubation: 37°C, Assay: 37°C	600 mM 2-Naphthyl acetate	Acetate , beta-naphtol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about assay buffer and pH

Stability - Incubation	Activity after incubation (1 hour at 37°C), measured by absorbance spectrophotometry (β-naphtol absorbance measurement, 555 nm) in aqueous phase	Ethanol	10%	100.0	93.64	%	Incubation: 50 mM potassium phosphate, Assay: 50 mM potassium phosphate	Incubation: 7, Assay: 7	Incubation: 37°C, Assay: 37°C	600 mM 2-Naphthyl acetate	Acetate, beta-naphtol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about assay buffer and pH
Stability - Incubation	Activity after incubation (1 hour at 37°C), measured by absorbance spectrophotometry (β-naphtol absorbance measurement, 555 nm) in aqueous phase	Methanol	10%	100.0	85.81	%	Incubation: 50 mM potassium phosphate, Assay: 50 mM potassium phosphate	Incubation: 7, Assay: 7	Incubation: 37°C, Assay: 37°C	600 mM 2-Naphthyl acetate	Acetate, beta-naphtol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about assay buffer and pH
Stability - Incubation	Activity after incubation (1 hour at 37°C), measured by absorbance spectrophotometry (β-naphtol absorbance measurement, 555 nm) in aqueous phase	Isopropanol	10%	100.0	126.9	%	Incubation: 50 mM potassium phosphate, Assay: 50 mM potassium phosphate	Incubation: 7, Assay: 7	Incubation: 37°C, Assay: 37°C	600 mM 2-Naphthyl acetate	Acetate, beta-naphtol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about assay buffer and pH
Stability - Incubation	Activity after incubation (1 hour at 37°C), measured by absorbance spectrophotometry (β-naphtol absorbance measurement, 555 nm) in aqueous phase	Acetone	10%	100.0	122.32	%	Incubation: 50 mM potassium phosphate, Assay: 50 mM potassium phosphate	Incubation: 7, Assay: 7	Incubation: 37°C, Assay: 37°C	600 mM 2-Naphthyl acetate	Acetate, beta-naphtol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about assay buffer and pH
Stability - Incubation	Activity after incubation (1 hour at 37°C), measured by absorbance spectrophotometry (β-naphtol absorbance measurement, 555 nm) in aqueous phase	n-Hexane	10%	100.0	130.23	%	Incubation: 50 mM potassium phosphate, Assay: 50 mM potassium phosphate	Incubation: 7, Assay: 7	Incubation: 37°C, Assay: 37°C	600 mM 2-Naphthyl acetate	Acetate, beta-naphtol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about assay buffer and pH
Stability - Incubation	Activity after incubation (1 hour at 37°C), measured by absorbance spectrophotometry (β-naphtol absorbance measurement, 555 nm) in aqueous phase	Acetonitrile	10%	100.0	82.85	%	Incubation: 50 mM potassium phosphate, Assay: 50 mM potassium phosphate	Incubation: 7, Assay: 7	Incubation: 37°C, Assay: 37°C	600 mM 2-Naphthyl acetate	Acetate, beta-naphtol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about assay buffer and pH

Visualization : Stability — Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate · Scroll to zoom · Right-click drag to pan · Powered by Mol*