Glycosyltransferase (gene PI-GT1) from Bacillus licheniformis PI15
Enzyme Description
Sequence
MGHKHIAIFNIPAHGHINPTLALTASLVKRGYRVTYPVTDEFVKAVEETGAEPLNYRSTLNIDPQQIRELMKNKKDMTQAPMMFMKEMEEVLPQLEALYENDKPDLILFDFMAMAGKMLAEKFGIEAVRLCSTYAQNEHFSFKSMSEEFKIELTPEQEAALKNANLPSFNFEEMFEPAKLNIVFMPRAFQPYGETFDERFSFVGPSLAKRKFQEKDTPVISDSGRPVMLISLGTAFNAWPEFYHMCIEAFRDTKWQVIMAVGTTIDPESFDDIPDNFSIHQRVPQLEILKKAELFITHGGMNSTMEGLNAGVPLVAVPQMPEQEITARRVEELGLGKHLQPEDTTVASLREAVSQTDGNLDVLKRVKDMQEHIKQAGGAEKAADEIESFLAPAGVK
Bingfeng Li et al. (2019)
β Biochemical characterization of an organic solvent-tolerant glycosyltransferase from Bacillus licheniformis PI15 with potential application for raspberry ketone glycoside production
Biotechnology and Applied Biochemistry
Β· doi:10.1002/bab.1841 β
Β· Activity - Classical Stability - Incubation
▼
Database ID
UniProt: A0A0E3N3Q3 β
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (14 measurements)
14 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Activity (amount of raspberry ketone glycosylation after 12 hours incubation) measured by HPLC | Dimethyl Sulfoxide (DMSO) | 5% | 100.0 | 97.0 | % | 50 mM sodium phosphate buffer | 8 | Room temperature | 3 mg/ml 4-(4'-Hydroxyphenyl)-2-butanone, 10 mg/ml Uridine diphosphate glucose | 4-(4'-Hydroxyphenyl)-2-butanone glucoside , UDP | β | 125 rpm | Classical aqueous control (in %) | Uncertainty about assay conditions |
| Activity - Classical | Activity (amount of raspberry ketone glycosylation after 12 hours incubation) measured by HPLC | Dimethyl Sulfoxide (DMSO) | 10% | 100.0 | 93.0 | % | 50 mM sodium phosphate buffer | 8 | Room temperature | 3 mg/ml 4-(4'-Hydroxyphenyl)-2-butanone, 10 mg/ml Uridine diphosphate glucose | 4-(4'-Hydroxyphenyl)-2-butanone glucoside , UDP | β | 125 rpm | Classical aqueous control (in %) | Uncertainty about assay conditions |
| Activity - Classical | Activity (amount of raspberry ketone glycosylation after 12 hours incubation) measured by HPLC | Dimethyl Sulfoxide (DMSO) | 15% | 100.0 | 86.0 | % | 50 mM sodium phosphate buffer | 8 | Room temperature | 3 mg/ml 4-(4'-Hydroxyphenyl)-2-butanone, 10 mg/ml Uridine diphosphate glucose | 4-(4'-Hydroxyphenyl)-2-butanone glucoside , UDP | β | 125 rpm | Classical aqueous control (in %) | Uncertainty about assay conditions |
| Activity - Classical | Activity (amount of raspberry ketone glycosylation after 12 hours incubation) measured by HPLC | Dimethyl Sulfoxide (DMSO) | 20% | 100.0 | 82.0 | % | 50 mM sodium phosphate buffer | 8 | Room temperature | 3 mg/ml 4-(4'-Hydroxyphenyl)-2-butanone, 10 mg/ml Uridine diphosphate glucose | 4-(4'-Hydroxyphenyl)-2-butanone glucoside , UDP | β | 125 rpm | Classical aqueous control (in %) | Uncertainty about assay conditions |
| Activity - Classical | Activity (amount of raspberry ketone glycosylation after 12 hours incubation) measured by HPLC | Dimethyl Sulfoxide (DMSO) | 25% | 100.0 | 64.0 | % | 50 mM sodium phosphate buffer | 8 | Room temperature | 3 mg/ml 4-(4'-Hydroxyphenyl)-2-butanone, 10 mg/ml Uridine diphosphate glucose | 4-(4'-Hydroxyphenyl)-2-butanone glucoside , UDP | β | 125 rpm | Classical aqueous control (in %) | Uncertainty about assay conditions |
| Activity - Classical | Activity (amount of raspberry ketone glycosylation after 12 hours incubation) measured by HPLC | Dimethyl Sulfoxide (DMSO) | 30% | 100.0 | 31.0 | % | 50 mM sodium phosphate buffer | 8 | Room temperature | 3 mg/ml 4-(4'-Hydroxyphenyl)-2-butanone, 10 mg/ml Uridine diphosphate glucose | 4-(4'-Hydroxyphenyl)-2-butanone glucoside , UDP | β | 125 rpm | Classical aqueous control (in %) | Uncertainty about assay conditions |
| Stability - Incubation | Activity after incubation (3 hours at room tempereature), measured by HPLC (amount of raspberry ketone glycosylation) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 5% | 100.0 | 92.3 | % | Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer | Incubation: 8, Assay: 8 | Incubation: Room temperature, Assay: Room temperature | 3 mg/ml 4-(4'-Hydroxyphenyl)-2-butanone, 10 mg/ml Uridine diphosphate glucose | 4-(4'-Hydroxyphenyl)-2-butanone glucoside , UDP | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent, uncertainty about control, uncertainty about assay conditions |
| Stability - Incubation | Activity after incubation (3 hours at room tempereature), measured by HPLC (amount of raspberry ketone glycosylation) in aqueous phase | Methanol | 5% | 100.0 | 88.5 | % | Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer | Incubation: 8, Assay: 8 | Incubation: Room temperature, Assay: Room temperature | 3 mg/ml 4-(4'-Hydroxyphenyl)-2-butanone, 10 mg/ml Uridine diphosphate glucose | 4-(4'-Hydroxyphenyl)-2-butanone glucoside , UDP | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent, uncertainty about control, uncertainty about assay conditions |
| Stability - Incubation | Activity after incubation (3 hours at room tempereature), measured by HPLC (amount of raspberry ketone glycosylation) in aqueous phase | Acetonitrile | 5% | 100.0 | 85.8 | % | Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer | Incubation: 8, Assay: 8 | Incubation: Room temperature, Assay: Room temperature | 3 mg/ml 4-(4'-Hydroxyphenyl)-2-butanone, 10 mg/ml Uridine diphosphate glucose | 4-(4'-Hydroxyphenyl)-2-butanone glucoside , UDP | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent, uncertainty about control, uncertainty about assay conditions |
| Stability - Incubation | Activity after incubation (3 hours at room tempereature), measured by HPLC (amount of raspberry ketone glycosylation) in aqueous phase | Ethanol | 5% | 100.0 | 90.4 | % | Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer | Incubation: 8, Assay: 8 | Incubation: Room temperature, Assay: Room temperature | 3 mg/ml 4-(4'-Hydroxyphenyl)-2-butanone, 10 mg/ml Uridine diphosphate glucose | 4-(4'-Hydroxyphenyl)-2-butanone glucoside , UDP | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent, uncertainty about control, uncertainty about assay conditions |
| Stability - Incubation | Activity after incubation (3 hours at room tempereature), measured by HPLC (amount of raspberry ketone glycosylation) in aqueous phase | Acetone | 5% | 100.0 | 71.9 | % | Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer | Incubation: 8, Assay: 8 | Incubation: Room temperature, Assay: Room temperature | 3 mg/ml 4-(4'-Hydroxyphenyl)-2-butanone, 10 mg/ml Uridine diphosphate glucose | 4-(4'-Hydroxyphenyl)-2-butanone glucoside , UDP | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent, uncertainty about control, uncertainty about assay conditions |
| Stability - Incubation | Activity after incubation (3 hours at room tempereature), measured by HPLC (amount of raspberry ketone glycosylation) in aqueous phase | Chloroform | 5% | 100.0 | 14.6 | % | Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer | Incubation: 8, Assay: 8 | Incubation: Room temperature, Assay: Room temperature | 3 mg/ml 4-(4'-Hydroxyphenyl)-2-butanone, 10 mg/ml Uridine diphosphate glucose | 4-(4'-Hydroxyphenyl)-2-butanone glucoside , UDP | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent, uncertainty about control, uncertainty about assay conditions |
| Stability - Incubation | Activity after incubation (3 hours at room tempereature), measured by HPLC (amount of raspberry ketone glycosylation) in aqueous phase | Benzene | 5% | 100.0 | 41.7 | % | Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer | Incubation: 8, Assay: 8 | Incubation: Room temperature, Assay: Room temperature | 3 mg/ml 4-(4'-Hydroxyphenyl)-2-butanone, 10 mg/ml Uridine diphosphate glucose | 4-(4'-Hydroxyphenyl)-2-butanone glucoside , UDP | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent, uncertainty about control, uncertainty about assay conditions |
| Stability - Incubation | Activity after incubation (3 hours at room tempereature), measured by HPLC (amount of raspberry ketone glycosylation) in aqueous phase | Cyclohexane | 5% | 100.0 | 32.4 | % | Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer | Incubation: 8, Assay: 8 | Incubation: Room temperature, Assay: Room temperature | 3 mg/ml 4-(4'-Hydroxyphenyl)-2-butanone, 10 mg/ml Uridine diphosphate glucose | 4-(4'-Hydroxyphenyl)-2-butanone glucoside , UDP | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent, uncertainty about control, uncertainty about assay conditions |
Visualization : Activity β Classical
One bar per measurement. Colour = solvent, shade = solvent volume.
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.