Glycosyltransferase (gene PI-GT1) from Bacillus licheniformis PI15

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 396 amino acids
MGHKHIAIFNIPAHGHINPTLALTASLVKRGYRVTYPVTDEFVKAVEETGAEPLNYRSTLNIDPQQIRELMKNKKDMTQAPMMFMKEMEEVLPQLEALYENDKPDLILFDFMAMAGKMLAEKFGIEAVRLCSTYAQNEHFSFKSMSEEFKIELTPEQEAALKNANLPSFNFEEMFEPAKLNIVFMPRAFQPYGETFDERFSFVGPSLAKRKFQEKDTPVISDSGRPVMLISLGTAFNAWPEFYHMCIEAFRDTKWQVIMAVGTTIDPESFDDIPDNFSIHQRVPQLEILKKAELFITHGGMNSTMEGLNAGVPLVAVPQMPEQEITARRVEELGLGKHLQPEDTTVASLREAVSQTDGNLDVLKRVKDMQEHIKQAGGAEKAADEIESFLAPAGVK
Bingfeng Li et al. (2019) β€” Biochemical characterization of an organic solvent-tolerant glycosyltransferase from Bacillus licheniformis PI15 with potential application for raspberry ketone glycoside production
Biotechnology and Applied Biochemistry  Β· doi:10.1002/bab.1841 β†—  Β· Activity - Classical Stability - Incubation
14 measurements
Database ID
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (14 measurements)

14 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity (amount of raspberry ketone glycosylation after 12 hours incubation) measured by HPLC Dimethyl Sulfoxide (DMSO) 5% 100.0 97.0 % 50 mM sodium phosphate buffer 8 Room temperature 3 mg/ml 4-(4'-Hydroxyphenyl)-2-butanone, 10 mg/ml Uridine diphosphate glucose 4-(4'-Hydroxyphenyl)-2-butanone glucoside , UDP β€” 125 rpm Classical aqueous control (in %) | Uncertainty about assay conditions
Activity - Classical Activity (amount of raspberry ketone glycosylation after 12 hours incubation) measured by HPLC Dimethyl Sulfoxide (DMSO) 10% 100.0 93.0 % 50 mM sodium phosphate buffer 8 Room temperature 3 mg/ml 4-(4'-Hydroxyphenyl)-2-butanone, 10 mg/ml Uridine diphosphate glucose 4-(4'-Hydroxyphenyl)-2-butanone glucoside , UDP β€” 125 rpm Classical aqueous control (in %) | Uncertainty about assay conditions
Activity - Classical Activity (amount of raspberry ketone glycosylation after 12 hours incubation) measured by HPLC Dimethyl Sulfoxide (DMSO) 15% 100.0 86.0 % 50 mM sodium phosphate buffer 8 Room temperature 3 mg/ml 4-(4'-Hydroxyphenyl)-2-butanone, 10 mg/ml Uridine diphosphate glucose 4-(4'-Hydroxyphenyl)-2-butanone glucoside , UDP β€” 125 rpm Classical aqueous control (in %) | Uncertainty about assay conditions
Activity - Classical Activity (amount of raspberry ketone glycosylation after 12 hours incubation) measured by HPLC Dimethyl Sulfoxide (DMSO) 20% 100.0 82.0 % 50 mM sodium phosphate buffer 8 Room temperature 3 mg/ml 4-(4'-Hydroxyphenyl)-2-butanone, 10 mg/ml Uridine diphosphate glucose 4-(4'-Hydroxyphenyl)-2-butanone glucoside , UDP β€” 125 rpm Classical aqueous control (in %) | Uncertainty about assay conditions
Activity - Classical Activity (amount of raspberry ketone glycosylation after 12 hours incubation) measured by HPLC Dimethyl Sulfoxide (DMSO) 25% 100.0 64.0 % 50 mM sodium phosphate buffer 8 Room temperature 3 mg/ml 4-(4'-Hydroxyphenyl)-2-butanone, 10 mg/ml Uridine diphosphate glucose 4-(4'-Hydroxyphenyl)-2-butanone glucoside , UDP β€” 125 rpm Classical aqueous control (in %) | Uncertainty about assay conditions
Activity - Classical Activity (amount of raspberry ketone glycosylation after 12 hours incubation) measured by HPLC Dimethyl Sulfoxide (DMSO) 30% 100.0 31.0 % 50 mM sodium phosphate buffer 8 Room temperature 3 mg/ml 4-(4'-Hydroxyphenyl)-2-butanone, 10 mg/ml Uridine diphosphate glucose 4-(4'-Hydroxyphenyl)-2-butanone glucoside , UDP β€” 125 rpm Classical aqueous control (in %) | Uncertainty about assay conditions
Stability - Incubation Activity after incubation (3 hours at room tempereature), measured by HPLC (amount of raspberry ketone glycosylation) in aqueous phase Dimethyl Sulfoxide (DMSO) 5% 100.0 92.3 % Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer Incubation: 8, Assay: 8 Incubation: Room temperature, Assay: Room temperature 3 mg/ml 4-(4'-Hydroxyphenyl)-2-butanone, 10 mg/ml Uridine diphosphate glucose 4-(4'-Hydroxyphenyl)-2-butanone glucoside , UDP β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent, uncertainty about control, uncertainty about assay conditions
Stability - Incubation Activity after incubation (3 hours at room tempereature), measured by HPLC (amount of raspberry ketone glycosylation) in aqueous phase Methanol 5% 100.0 88.5 % Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer Incubation: 8, Assay: 8 Incubation: Room temperature, Assay: Room temperature 3 mg/ml 4-(4'-Hydroxyphenyl)-2-butanone, 10 mg/ml Uridine diphosphate glucose 4-(4'-Hydroxyphenyl)-2-butanone glucoside , UDP β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent, uncertainty about control, uncertainty about assay conditions
Stability - Incubation Activity after incubation (3 hours at room tempereature), measured by HPLC (amount of raspberry ketone glycosylation) in aqueous phase Acetonitrile 5% 100.0 85.8 % Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer Incubation: 8, Assay: 8 Incubation: Room temperature, Assay: Room temperature 3 mg/ml 4-(4'-Hydroxyphenyl)-2-butanone, 10 mg/ml Uridine diphosphate glucose 4-(4'-Hydroxyphenyl)-2-butanone glucoside , UDP β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent, uncertainty about control, uncertainty about assay conditions
Stability - Incubation Activity after incubation (3 hours at room tempereature), measured by HPLC (amount of raspberry ketone glycosylation) in aqueous phase Ethanol 5% 100.0 90.4 % Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer Incubation: 8, Assay: 8 Incubation: Room temperature, Assay: Room temperature 3 mg/ml 4-(4'-Hydroxyphenyl)-2-butanone, 10 mg/ml Uridine diphosphate glucose 4-(4'-Hydroxyphenyl)-2-butanone glucoside , UDP β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent, uncertainty about control, uncertainty about assay conditions
Stability - Incubation Activity after incubation (3 hours at room tempereature), measured by HPLC (amount of raspberry ketone glycosylation) in aqueous phase Acetone 5% 100.0 71.9 % Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer Incubation: 8, Assay: 8 Incubation: Room temperature, Assay: Room temperature 3 mg/ml 4-(4'-Hydroxyphenyl)-2-butanone, 10 mg/ml Uridine diphosphate glucose 4-(4'-Hydroxyphenyl)-2-butanone glucoside , UDP β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent, uncertainty about control, uncertainty about assay conditions
Stability - Incubation Activity after incubation (3 hours at room tempereature), measured by HPLC (amount of raspberry ketone glycosylation) in aqueous phase Chloroform 5% 100.0 14.6 % Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer Incubation: 8, Assay: 8 Incubation: Room temperature, Assay: Room temperature 3 mg/ml 4-(4'-Hydroxyphenyl)-2-butanone, 10 mg/ml Uridine diphosphate glucose 4-(4'-Hydroxyphenyl)-2-butanone glucoside , UDP β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent, uncertainty about control, uncertainty about assay conditions
Stability - Incubation Activity after incubation (3 hours at room tempereature), measured by HPLC (amount of raspberry ketone glycosylation) in aqueous phase Benzene 5% 100.0 41.7 % Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer Incubation: 8, Assay: 8 Incubation: Room temperature, Assay: Room temperature 3 mg/ml 4-(4'-Hydroxyphenyl)-2-butanone, 10 mg/ml Uridine diphosphate glucose 4-(4'-Hydroxyphenyl)-2-butanone glucoside , UDP β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent, uncertainty about control, uncertainty about assay conditions
Stability - Incubation Activity after incubation (3 hours at room tempereature), measured by HPLC (amount of raspberry ketone glycosylation) in aqueous phase Cyclohexane 5% 100.0 32.4 % Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer Incubation: 8, Assay: 8 Incubation: Room temperature, Assay: Room temperature 3 mg/ml 4-(4'-Hydroxyphenyl)-2-butanone, 10 mg/ml Uridine diphosphate glucose 4-(4'-Hydroxyphenyl)-2-butanone glucoside , UDP β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent, uncertainty about control, uncertainty about assay conditions

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*