Cysteine protease from Ervatamia coronaria

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 208 amino acids
LPEQIDWRKKGAVTPVKNQGSCGSCWAFSTVSTVESINQIRTGNLISLSEQELVDCDKKNHGCLGGAFVFAYQYIINNGGIDTQANYPYKAVQGPCQAASKVVSIDGYNGVPFCNEXALKQAVAVQPSTVAIDASSAQFQQYSSGIFSGPCGTKLNHGVTIVGYQANYWIVRNSWGRYWGEKGYIRMLRVGGCGLCGIARLPYYPTKA
Monica Sundd et al. (1998) β€” Purification and Characterization of a Highly Stable Cysteine Protease from the Latex of Ervatamia coronaria
Bioscience, Biotechnology, and Biochemistry  Β· doi:10.1271/bbb.62.1947 β†—  Β· Activity - Classical
3 measurements
Database ID
UniProt: P83654 β†—
Sequence Annotation
Inferred - from protein name
Protein Source
Purified, eukaryote Ervatamia coronaria

Experimental Data (3 measurements)

3 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, azopeptides absorbance measurement, 440 nm) in the presence of organic solvent Acetonitrile 40% 100 100 % 0.05 M Tris-HCl 8 37Β°C ? mM Azoalbumin azopeptides , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, azopeptides absorbance measurement, 440 nm) in the presence of organic solvent Ethanol 70% 100 100 % 0.05 M Tris-HCl 8 37Β°C ? mM Azoalbumin azopeptides , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, azopeptides absorbance measurement, 440 nm) in the presence of organic solvent Methanol 50% 100 100 % 0.05 M Tris-HCl 8 37Β°C ? mM Azoalbumin azopeptides , Peptides β€” β€” Classical aqueous control (in %)

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*