Lipase (gene lipP) from Pseudomonas sp. B11-1

Enzyme Description

Species
Pseudomonas sp. B11-1 β†—
Extremophile
No but "psychrotrophic" organism and"cold-adapted" enzyme
EC Number
3.1.1.3 β†—

Sequence

Length: 308 amino acids
MPLDKQIAAVLQQFSELPAPDFSQLDAAQYRQFCDNLLPAIPGDPMIEVRNLRVAAAAGELDARLYRPLEEDNLPLLVFFHGGGFVMGNLDTHDNLCRSLASQTEAVVVSVAYRLAPENHFPAAPLDCYAATCWLVEHAAELGVDGRRLALAGDSAGGNLALAVSRLAAQRQGPKISYQCLFYPVTDARCDSQSYEEFAEGYFLTGAMMYWFWQQYLQDTGQGDDPLASPLRAETLADLPPTTLITAEFDPLRDEGEAFALRLQQAGVSVRVQRCEGMIHGFISMAPFVERAAHALSDAAADLRRALN
Dong-Won Choo et al. (1998) β€” A cold-adapted lipase of an Alaskan psychrotroph, Pseudomonas sp. strain B11-1: gene cloning and enzyme purification and characterization
Applied and Environmental Microbiology  Β· doi:10.1128/AEM.64.2.486-491.1998 β†—  Β· Stability - Incubation
10 measurements ▼
Database ID
UniProt: O52270 β†—
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli C600

Experimental Data (10 measurements)

10 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 400 nm) in aqueous phase Acetonitrile 15% 100 34 % Incubation: 20 mM Tris/HCl buffer, Assay: 20 mM Tris/HCl buffer Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: 25Β°C 0.5 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 400 nm) in aqueous phase Acetonitrile 30% 100 0 % Incubation: 20 mM Tris/HCl buffer, Assay: 20 mM Tris/HCl buffer Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: 25Β°C 0.5 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 400 nm) in aqueous phase Ethanol 15% 100 132 % Incubation: 20 mM Tris/HCl buffer, Assay: 20 mM Tris/HCl buffer Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: 25Β°C 0.5 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 400 nm) in aqueous phase Ethanol 30% 100 38 % Incubation: 20 mM Tris/HCl buffer, Assay: 20 mM Tris/HCl buffer Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: 25Β°C 0.5 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 400 nm) in aqueous phase Methanol 15% 100 194 % Incubation: 20 mM Tris/HCl buffer, Assay: 20 mM Tris/HCl buffer Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: 25Β°C 0.5 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 400 nm) in aqueous phase Methanol 30% 100 107 % Incubation: 20 mM Tris/HCl buffer, Assay: 20 mM Tris/HCl buffer Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: 25Β°C 0.5 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 400 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 15% 100 142 % Incubation: 20 mM Tris/HCl buffer, Assay: 20 mM Tris/HCl buffer Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: 25Β°C 0.5 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 400 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 30% 100 149 % Incubation: 20 mM Tris/HCl buffer, Assay: 20 mM Tris/HCl buffer Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: 25Β°C 0.5 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 400 nm) in aqueous phase Dimethylformamide (DMF) 15% 100 130 % Incubation: 20 mM Tris/HCl buffer, Assay: 20 mM Tris/HCl buffer Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: 25Β°C 0.5 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 400 nm) in aqueous phase Dimethylformamide (DMF) 30% 100 80 % Incubation: 20 mM Tris/HCl buffer, Assay: 20 mM Tris/HCl buffer Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: 25Β°C 0.5 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*