Tannase (gene LpTanQA1-5) from Lactobacillus pentosus QA1-5

Enzyme Description

Species
Lactobacillus pentosus QA1-5 β†—
Extremophile
No
EC Number
3.1.1.20 β†—

Sequence

Length: 470 amino acids
MTDTLIFDSDWLTPEQIQLDGKTINYLAAHDIQYVQHPVAAIQRLNVFVPAAYDNGWTANAYPPDTAPIFMPNTVGGYFPGPADDPTRTQWPNNAPTIKQALKRGYVVIAAGLRGHTTVNESGQRVGQAPAFIVDLKAAVRYVKYNQARLPGNVQRIITNGTSAGGATSALMGASGKSKFFEGRFPSLGAARATDDIFAVSAYCPIHNLEHADMAYEWQFNGINDWNRSQPVAGSMKNGRPKFESITGTLSANDQSLSADLKRQFCDYLNGLQLHDANGQALTVSPDGTGTFQNYLVQLLTDSAQSALDKGVDIHKYAGFTVTNGKVTGLDLKAYFTSLTRMKAVPAFDQLDLGSLENRLFGDATVLNRHFTSFSQEHTTVPAQLAETELVEPVNPLTYLTGNQSAKIAQHWRIRHGAADRDTSFAIPIILATVLQNQGQDVDFALPWDIPHSGDYDLGELFAWIDGLCQ
Apinun Kanpiengjai et al. (2019) β€” Expression and biochemical characterization of a new alkaline tannase from Lactobacillus pentosus
Protein Expression and Purification  Β· doi:10.1016/j.pep.2019.01.005 β†—  Β· Stability - Incubation
7 measurements ▼
Database ID
UniParc: UPI000D222E21 β†—
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (7 measurements)

7 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (30 minutes at room temperature), measured by absorbance spectrophotometry (colorimetric assay, absorbance measurement of the reaction product of rhodanine with Gallic Acid, 520 nm) in aqueous phase Isoamyl Alcohol 20% 100.0 124.5 % Incubation: ?, Assay: 100 mM sodium phosphate buffer Incubation: ?, Assay: 6.5 Incubation: Room temperature, Assay: 30Β°C 6.25 mM Methyl gallate Gallic Acid , Methanol β€” Assay: 600 rpm Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (30 minutes at room temperature), measured by absorbance spectrophotometry (colorimetric assay, absorbance measurement of the reaction product of rhodanine with Gallic Acid, 520 nm) in aqueous phase Ethanol 20% 100.0 121.6 % Incubation: ?, Assay: 100 mM sodium phosphate buffer Incubation: ?, Assay: 6.5 Incubation: Room temperature, Assay: 30Β°C 6.25 mM Methyl gallate Gallic Acid , Methanol β€” Assay: 600 rpm Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (30 minutes at room temperature), measured by absorbance spectrophotometry (colorimetric assay, absorbance measurement of the reaction product of rhodanine with Gallic Acid, 520 nm) in aqueous phase Isopropanol 20% 100.0 125.4 % Incubation: ?, Assay: 100 mM sodium phosphate buffer Incubation: ?, Assay: 6.5 Incubation: Room temperature, Assay: 30Β°C 6.25 mM Methyl gallate Gallic Acid , Methanol β€” Assay: 600 rpm Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (30 minutes at room temperature), measured by absorbance spectrophotometry (colorimetric assay, absorbance measurement of the reaction product of rhodanine with Gallic Acid, 520 nm) in aqueous phase Methanol 20% 100.0 102.1 % Incubation: ?, Assay: 100 mM sodium phosphate buffer Incubation: ?, Assay: 6.5 Incubation: Room temperature, Assay: 30Β°C 6.25 mM Methyl gallate Gallic Acid , Methanol β€” Assay: 600 rpm Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (30 minutes at room temperature), measured by absorbance spectrophotometry (colorimetric assay, absorbance measurement of the reaction product of rhodanine with Gallic Acid, 520 nm) in aqueous phase n-Hexane 20% 100.0 100.1 % Incubation: ?, Assay: 100 mM sodium phosphate buffer Incubation: ?, Assay: 6.5 Incubation: Room temperature, Assay: 30Β°C 6.25 mM Methyl gallate Gallic Acid , Methanol β€” Assay: 600 rpm Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (30 minutes at room temperature), measured by absorbance spectrophotometry (colorimetric assay, absorbance measurement of the reaction product of rhodanine with Gallic Acid, 520 nm) in aqueous phase Toluene 20% 100.0 63.8 % Incubation: ?, Assay: 100 mM sodium phosphate buffer Incubation: ?, Assay: 6.5 Incubation: Room temperature, Assay: 30Β°C 6.25 mM Methyl gallate Gallic Acid , Methanol β€” Assay: 600 rpm Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (30 minutes at room temperature), measured by absorbance spectrophotometry (colorimetric assay, absorbance measurement of the reaction product of rhodanine with Gallic Acid, 520 nm) in aqueous phase Petroleum Ether 20% 100.0 90.1 % Incubation: ?, Assay: 100 mM sodium phosphate buffer Incubation: ?, Assay: 6.5 Incubation: Room temperature, Assay: 30Β°C 6.25 mM Methyl gallate Gallic Acid , Methanol β€” Assay: 600 rpm Non-incubated control (in %), assay in aqueous phase

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*