Transaminase (gene VbTA) from Virgibacillus 21D

Enzyme Description

Species
Virgibacillus 21D β†—
Extremophile
No but "halotolerant" enzyme
EC Number
2.6.1.18 β†—

Sequence

Length: 448 amino acids
MRSLTELDKKHFIHPFSSIQEQQHKGAKVIMKEGDGIYLTDVTGKTYIDGVSSLWNVNVGHGRVELAEAAAQQMKKMAFSSAFSTFSHEPAIRLAEKIASITPEGLNAVFFTSGGSESNDSAVKLVRHYWKIQGKPNKRKIISLKRSYHGVAAASTSVTGIPEFWGMAGHMMTDFLHVDTHYNNTTEQAVQSLCQAIEEAGPETIAAFFAEPVQGAGGVIIPPEDYFLRIREVCNAYGILFVADEVITGFGRTGKMFGIENWDVIPDVMTFAKGVTSGYFPLGGVVVSDPIHEVLKEKSVGTLFHGFTYSGHPTAAAVALKNIAIIKEERLVENSKRMGDALLHGLKKVKNRLEIVGDVRFVGLLGAVELMQNPATNKPFSSNLQVAPKVIEALHELGVICRSVTYDHTNIICLAPPLIINQKQVDKLVEVIYEAILKVQQQLGIKAE
Benedetta Guidi et al. (2018) β€” Strategic single point mutation yields a solvent- and salt-stable transaminase from Virgibacillus sp. in soluble form
Scientific Reports  Β· doi:10.1038/s41598-018-34434-3 β†—  Β· Stability - Incubation
10 measurements ▼
Database ID
UniProt: A0A4P1LYG1 β†—
Sequence Annotation
Explicit - Provided (25 first residues from UniProt sequence absent from the mature protein)
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (10 measurements)

10 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (2 days at 25Β°C), measured by absorbance spectrophotometry (acetophenone absorbance measurement, 245 nm) in the presence of organic solvent Methanol 10% 100 95 % ? Incubation, 100 mM potassium phosphate buffer Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 37Β°C 10 mM (S)-1-Phenylethylamine, 10 mM Pyruvate Acetophenone , L-Alanine ? mM PLP β€” Non-incubated control (in %) in the presence of organic solvent, assay in the presence of organic solvent | Mutation T16F already accounted for on UniProt
Stability - Incubation Activity after incubation (2 days at 25Β°C), measured by absorbance spectrophotometry (acetophenone absorbance measurement, 245 nm) in the presence of organic solvent Methanol 20% 100 94 % ? Incubation, 100 mM potassium phosphate buffer Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 37Β°C 10 mM (S)-1-Phenylethylamine, 10 mM Pyruvate Acetophenone , L-Alanine ? mM PLP β€” Non-incubated control (in %) in the presence of organic solvent, assay in the presence of organic solvent | Mutation T16F already accounted for on UniProt
Stability - Incubation Activity after incubation (2 days at 25Β°C), measured by absorbance spectrophotometry (acetophenone absorbance measurement, 245 nm) in the presence of organic solvent Ethanol 10% 100 96 % ? Incubation, 100 mM potassium phosphate buffer Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 37Β°C 10 mM (S)-1-Phenylethylamine, 10 mM Pyruvate Acetophenone , L-Alanine ? mM PLP β€” Non-incubated control (in %) in the presence of organic solvent, assay in the presence of organic solvent | Mutation T16F already accounted for on UniProt
Stability - Incubation Activity after incubation (2 days at 25Β°C), measured by absorbance spectrophotometry (acetophenone absorbance measurement, 245 nm) in the presence of organic solvent Ethanol 20% 100 79 % ? Incubation, 100 mM potassium phosphate buffer Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 37Β°C 10 mM (S)-1-Phenylethylamine, 10 mM Pyruvate Acetophenone , L-Alanine ? mM PLP β€” Non-incubated control (in %) in the presence of organic solvent, assay in the presence of organic solvent | Mutation T16F already accounted for on UniProt
Stability - Incubation Activity after incubation (2 days at 25Β°C), measured by absorbance spectrophotometry (acetophenone absorbance measurement, 245 nm) in the presence of organic solvent Isopropanol 10% 100 96 % ? Incubation, 100 mM potassium phosphate buffer Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 37Β°C 10 mM (S)-1-Phenylethylamine, 10 mM Pyruvate Acetophenone , L-Alanine ? mM PLP β€” Non-incubated control (in %) in the presence of organic solvent, assay in the presence of organic solvent | Mutation T16F already accounted for on UniProt
Stability - Incubation Activity after incubation (2 days at 25Β°C), measured by absorbance spectrophotometry (acetophenone absorbance measurement, 245 nm) in the presence of organic solvent Isopropanol 20% 100 77 % ? Incubation, 100 mM potassium phosphate buffer Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 37Β°C 10 mM (S)-1-Phenylethylamine, 10 mM Pyruvate Acetophenone , L-Alanine ? mM PLP β€” Non-incubated control (in %) in the presence of organic solvent, assay in the presence of organic solvent | Mutation T16F already accounted for on UniProt
Stability - Incubation Activity after incubation (2 days at 25Β°C), measured by absorbance spectrophotometry (acetophenone absorbance measurement, 245 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 10% 100 88 % ? Incubation, 100 mM potassium phosphate buffer Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 37Β°C 10 mM (S)-1-Phenylethylamine, 10 mM Pyruvate Acetophenone , L-Alanine ? mM PLP β€” Non-incubated control (in %) in the presence of organic solvent, assay in the presence of organic solvent | Mutation T16F already accounted for on UniProt
Stability - Incubation Activity after incubation (2 days at 25Β°C), measured by absorbance spectrophotometry (acetophenone absorbance measurement, 245 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 20% 100 80 % ? Incubation, 100 mM potassium phosphate buffer Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 37Β°C 10 mM (S)-1-Phenylethylamine, 10 mM Pyruvate Acetophenone , L-Alanine ? mM PLP β€” Non-incubated control (in %) in the presence of organic solvent, assay in the presence of organic solvent | Mutation T16F already accounted for on UniProt
Stability - Incubation Activity after incubation (2 days at 25Β°C), measured by absorbance spectrophotometry (acetophenone absorbance measurement, 245 nm) in the presence of organic solvent Tetrahydrofuran (THF) 10% 100 78 % ? Incubation, 100 mM potassium phosphate buffer Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 37Β°C 10 mM (S)-1-Phenylethylamine, 10 mM Pyruvate Acetophenone , L-Alanine ? mM PLP β€” Non-incubated control (in %) in the presence of organic solvent, assay in the presence of organic solvent | Mutation T16F already accounted for on UniProt
Stability - Incubation Activity after incubation (2 days at 25Β°C), measured by absorbance spectrophotometry (acetophenone absorbance measurement, 245 nm) in the presence of organic solvent Tetrahydrofuran (THF) 20% 100 42 % ? Incubation, 100 mM potassium phosphate buffer Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 37Β°C 10 mM (S)-1-Phenylethylamine, 10 mM Pyruvate Acetophenone , L-Alanine ? mM PLP β€” Non-incubated control (in %) in the presence of organic solvent, assay in the presence of organic solvent | Mutation T16F already accounted for on UniProt

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*