Carbonyl reductase from Rhodococcus erythropolis WZ010
Enzyme Description
Sequence
MKAIQYTRIGAEPELTEIPKPEPGPGEVLLEVTAAGVCHSDDFIMSLPEEQYTYGLPLTLGHEGAGRVAAVGEGVEGLDIGTNVVVYGPWGCGSCWHCSQGLENYCSRAKELGINPPGLGAPGALAEFMIVDSPRHLVPIGDLDPVKTVPLTDAGLTPYHAIKRSLPKLRGGSYAVVIGTGGLGHVAIQLLRHLSAATVIALDVSADKLELATKVGAHEVVLSDKDAAENVRSITGSQGAALVLDFVGYQPTIDTAMAVAGVGSDVTIVGIGDGQAHAKVGFFQSPYEASVTVPYWGARNELIELIDLAHAGIFDIAVETFSLDNGAEAYRRLAAGTLSGRAVVVPGL
Xiangxian Ying et al. (2018)
β Characterization of a Carbonyl Reductase from Rhodococcus erythropolis WZ010 and Its Variant Y54F for Asymmetric Synthesis of (S)-N-Boc-3-Hydroxypiperidine
Molecules
Β· doi:10.3390/molecules23123117 β
Β· Stability - Incubation
▼
Database ID
UniParc: UPI0004C464FA β
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (4 measurements)
4 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (3.5 hours at 35Β°C), measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in aqueous phase | 2-Octanol | 40% | 100 | 68 | % | ? Incubation, 50 mM PIPES buffer | Incubation: ?, Assay: 6 | Incubation: 35Β°C, Assay: 60Β°C | 10 mM 1-Boc-3-piperidone | (S)-N-Boc-3-hydroxypiperidine | 0.4 mM NADH | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent, uncertainty about control, uncertainty about EC number |
| Stability - Incubation | Activity after incubation (3.5 hours at 35Β°C), measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in aqueous phase | Isopropanol | 20% | 100 | 29 | % | ? Incubation, 50 mM PIPES buffer | Incubation: ?, Assay: 6 | Incubation: 35Β°C, Assay: 60Β°C | 10 mM 1-Boc-3-piperidone | (S)-N-Boc-3-hydroxypiperidine | 0.4 mM NADH | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent, uncertainty about control, uncertainty about EC number |
| Stability - Incubation | Activity after incubation (3.5 hours at 35Β°C), measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in aqueous phase | Acetone | 20% | 100 | 59 | % | ? Incubation, 50 mM PIPES buffer | Incubation: ?, Assay: 6 | Incubation: 35Β°C, Assay: 60Β°C | 10 mM 1-Boc-3-piperidone | (S)-N-Boc-3-hydroxypiperidine | 0.4 mM NADH | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent, uncertainty about control, uncertainty about EC number |
| Stability - Incubation | Activity after incubation (3.5 hours at 35Β°C), measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in aqueous phase | 2-Octanone | 40% | 100 | 58 | % | ? Incubation, 50 mM PIPES buffer | Incubation: ?, Assay: 6 | Incubation: 35Β°C, Assay: 60Β°C | 10 mM 1-Boc-3-piperidone | (S)-N-Boc-3-hydroxypiperidine | 0.4 mM NADH | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent, uncertainty about control, uncertainty about EC number |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.